KEGG   Chelatococcus sp. CO-6: AL346_01240Help
Entry
AL346_01240       CDS       T04040                                 

Definition
(GenBank) methionine gamma-lyase
  KO
K01761  methionine-gamma-lyase [EC:4.4.1.11]
Organism
chel  Chelatococcus sp. CO-6
Pathway
chel00270  Cysteine and methionine metabolism
chel00450  Selenocompound metabolism
chel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:chel00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AL346_01240
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AL346_01240
Enzymes [BR:chel01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.11  methionine gamma-lyase
     AL346_01240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_1_2 UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: ALA16282
UniProt: A0A0K2D8E5
LinkDB All DBs
Position
226083..227366
Genome map
AA seq 427 aa AA seqDB search
MASSDYHKDKIGNHKLHPETLMLGYGYDPALSEGAVKQPVFLTSTFVFRSAEEGRDFFDF
TAGRREPEPGTEPGLVYSRFNHPNSEIVEDRLAIFEGAEMGAIFSSGMSAIATTLLAFAR
PGDVILHSQPLYGGTETLIARTMKPFGIDAVGFIDGVDEAAVRAAAEAAMAKGRVSVVFV
ETPSNPLNSLVDLALVRRVADEIGDRQGHRPIVACDNTLLGPLFQKPLAHGMDLSVYSLT
KYVGGHSDLVAGAVLGRRELVKPIKLLRGAIGTQLDPHSAWMIARSLETLSLRMSAACRN
AEAVTAFLAGHEKVARVYYPTLLPAESPARRTFARQCDAAGTTFSFDIRGGEAAAFRFLN
ALRIFKLAVSLGGTESLVCHPATTVHSGVPKETRERIGISDATIRMSIGIEHSDDLIADL
TQALSVA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgtctgactaccacaaggacaagatcggcaatcacaagctccatcccgagacg
ctgatgctgggctacggctacgaccccgccctctcggaaggagcggtgaagcagccggtc
ttcctgacctccaccttcgtctttcgctcggcggaggaagggcgcgacttcttcgatttc
accgcgggccggcgcgagccggagccgggcaccgagccaggcctcgtctattcgcgcttc
aaccaccccaacagcgagatcgtcgaggatcgcctcgccatcttcgagggcgccgagatg
ggcgccatcttctcgagcggcatgtcggccatcgccacgacgctgctcgccttcgcccgg
ccgggtgacgtcatcctgcattcgcagccgctctacggcggcaccgaaacgctgatcgcc
aggacgatgaagcccttcggcatcgatgcggtcggcttcatcgacggcgtcgacgaggcg
gccgtgcgcgccgcggccgaggcggcgatggcgaagggccgcgtcagcgtcgtcttcgtc
gagacgccgtcgaaccccctcaacagcctcgtcgacctcgcgctcgtgcgccgtgtcgcc
gacgagatcggcgacaggcagggccaccgcccgatcgtcgcctgcgacaacacgctgctc
ggaccgctgttccagaagccgctcgcccacggcatggacctgtcggtctattcgctgacg
aagtacgtcggcggccactccgacctcgtggcaggggcggtgctcggccggcgcgagctg
gtgaagccgatcaagctgctgcgcggcgccatcggcacccagctcgacccgcattcggcc
tggatgatcgcccgctcgctggagacgctcagcctgcgcatgagcgccgcctgccgtaac
gccgaggcggtcaccgccttcctcgccggccacgagaaggtggcgcgcgtctattacccg
acgctgctgcccgccgagagcccggcccggcgcaccttcgcgcgccagtgcgatgcggcc
ggcaccaccttctccttcgacatccgcggtggcgaggcggcggccttccgcttcctcaac
gcgctgcgcatcttcaagctggcggtgagcctcggcggcacggaatcgctcgtctgccat
ccggcgacgaccgtccattccggcgtgccgaaggaaacgcgcgagcgcatcggcatcagc
gacgccaccatccgcatgtccatcggcatcgagcactcggacgacctcatcgccgacctg
acgcaggcgctgtcggtggcttag

DBGET integrated database retrieval system