KEGG   Chelatococcus sp. CO-6: AL346_06340Help
Entry
AL346_06340       CDS       T04040                                 

Definition
(GenBank) hypothetical protein
  KO
K03230  type III secretion protein V
Organism
chel  Chelatococcus sp. CO-6
Pathway
chel03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:chel00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    AL346_06340
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:chel02044]
    AL346_06340
Secretion system [BR:chel02044]
 Type III secretion system
  Type III secretion core apparatus
   AL346_06340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FHIPEP
Motif
Other DBs
NCBI-ProteinID: ALA17087
UniProt: A0A0K2DAQ9
LinkDB All DBs
Position
1346355..1348466
Genome map
AA seq 703 aa AA seqDB search
MPASFLKKILLAASQRGDIAFALLVVVAVMMMIIPLPTGLVDVLIACNIAASTLILLVAF
YIKRATDLSSLPTIVLMAVLFRIALAITTTRLILLQGDAGETVEAFGTFVIGGNVAVGLI
VFLIITVAQFVVITKGAERVAEVGARFTLDALPGKQMNIDNDLRSGAIDQAEAQRRRSLL
ERESQFYGAMDGSMKFVKGDAIAGLVVIIINLLGGLTIGVLQRGMTLGDAALRYSLLTVG
DGLIAQIPALLVSMAAGTVVTRVGSDGDQDVGSAIFSQLSRDPRAFGLVAAVLAALALLP
GFPTLVFLVLAAIFAGGTWLMLRGTARTAAAAEGLRAATRALEPRLVLRLGPDLAAAIPP
APLAIEIDRIRAGLLTRIGLRLPNLAVRADAALPGDAFSLDLDGTPEERGTLPAGHLAVS
ARAMDLDLAGLPYEEEGATQHHAETVWVPEAHRDALEAAGFTARERREVLLKRVEETLGN
TAMHFLGLQETRNLLAQIEGEYGELVGEVQKLIPLQTLAELLRGLVAEQVPIRNLRLILE
AIVEWAQYHREVITLEGFVRSTLRRQICFRWADENRVIAAYVLEREIEELVRVVLQQGFG
SAGARDSLALLAARIREHLQDPPPAPLPVVLAQRDVRLGLRQILLQEGLRLPVLAYDEIA
PDYFVQTVATVTVTPDGLLVLQAAAQEAAREPPQEAGIEAAGA
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgccggcaagcttcctcaagaagatcctcctggccgcctcccagcggggcgacatcgcc
ttcgcgctcctcgtggtggtcgcggtgatgatgatgatcatcccgctgccgacggggctc
gtcgacgtgctcatcgcctgcaacatcgccgcgagcacgctcatcctcctcgtcgccttc
tacatcaagcgggcgacggatctgtcctcgctgccgaccatcgtgctgatggcagtgctg
ttccgcatcgcgctcgccatcacgacgacgcggctcatcctgctgcagggcgatgccggc
gagacggtggaggccttcggcaccttcgtcatcggcggcaatgtcgcggtgggcctcatc
gtcttcctgatcatcaccgtggcccagttcgtcgtcatcaccaagggcgccgagcgcgtg
gccgaagtcggcgcgcgcttcaccctcgatgccctgcccggcaagcagatgaacatcgac
aacgatctgcgcagcggcgccatcgaccaggcggaggcgcagcggcggcgcagcctgctg
gagcgcgagagccagttttacggcgcgatggacggatcgatgaaattcgtcaagggcgat
gccatcgccggcctcgtcgtcatcatcatcaacctgctcggcggcctgaccatcggcgtc
ctccaacgcggcatgaccctcggcgacgcggcgctgcgctattcgctgctgaccgtcggc
gacggcctcatcgcgcagattcccgcccttctcgtgtcgatggccgccggcacggtggtg
acgcgcgtcggcagcgacggcgatcaggacgtcggctcggccatcttcagccagctctcg
cgcgacccgcgcgccttcggcctcgttgccgccgtgctcgccgccctcgcccttctcccc
ggctttcccaccctggtgttcctcgtgctggcggcgatcttcgccggcggcacatggctc
atgctgcgcggcacggcgcgcacggccgcggccgccgagggtctccgggccgccacccgg
gcgctcgagccgcgcctcgtgctgcggctggggccggatctcgccgccgccatcccgccc
gctccccttgcgatcgagatcgaccgcatccgcgcagggctcctcacgaggatcgggctg
cgcctgccgaacctcgccgtgcgcgcggacgcggccctgcctggcgatgccttcagcctc
gacctcgacggcacgccggaggaaagagggaccctgccggcgggccatctcgccgtctcg
gcccgcgcgatggacctcgatctcgccggcctgccctacgaggaggagggcgcgacgcag
caccacgccgaaaccgtctgggtgcctgaggcgcatcgggatgccctggaagccgccggc
ttcacggcccgcgagcgtcgcgaggtcctgctgaagcgggtggaggagacgctcggcaac
acggccatgcacttcctcgggctgcaggagacgcgcaacctcctggcgcagatcgagggc
gagtacggcgagctcgtcggcgaggtgcagaagctcattccgctgcagacgctggccgag
ctgctgcgcggcctcgtcgccgagcaggtgccgatccgcaacctgcgcctcatcctcgag
gccatcgtggaatgggcgcagtatcaccgcgaggtgatcacgctcgagggcttcgtgcgc
agcacgctgcgccgtcagatctgcttccgctgggcggacgagaaccgcgtcatcgccgcc
tacgtcctggagcgcgagatcgaggagctcgtgcgtgtggtgctgcagcagggcttcggc
agcgccggcgcccgcgattcgctcgcgctgctcgccgcgcggatccgcgagcacctgcag
gatccgccgcccgcgcccctgccggtcgtcctcgcccagcgcgacgttcgcctcggcttg
cgccagatcctgctgcaggaaggcttgcggctgccggtgctcgcctatgacgagatcgcg
ccggactatttcgtccagacggtcgccaccgtcaccgtcacgcccgacggtctcctcgtc
ctgcaggcggccgcgcaggaagcggcacgggagccgccgcaggaggccgggatcgaggcg
gccggcgcctga

DBGET integrated database retrieval system