KEGG   Chelatococcus sp. CO-6: AL346_13500Help
Entry
AL346_13500       CDS       T04040                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
chel  Chelatococcus sp. CO-6
Pathway
chel00061  Fatty acid biosynthesis
chel00780  Biotin metabolism
chel01100  Metabolic pathways
chel01130  Biosynthesis of antibiotics
chel01212  Fatty acid metabolism
Module
chel_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:chel00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AL346_13500
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    AL346_13500
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    AL346_13500
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:chel01004]
    AL346_13500
Enzymes [BR:chel01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     AL346_13500
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     AL346_13500
Lipid biosynthesis proteins [BR:chel01004]
 Fatty acid synthase
  Component type
   AL346_13500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: ALA19717
UniProt: A0A0K2DID4
LinkDB All DBs
Position
2862759..2863556
Genome map
AA seq 265 aa AA seqDB search
MSGKRGLIMGVANNRSIAWGIAKAAHAHGAELAFTYQGDALKKRVEPLAAELGAGVVGHC
DVTDGATIDAVFAEVEKRWGKLDFLVHAIAFSDKDELTGRYVDTTPENFSKSLLISCYSL
TAIAQRAEKLMKDGGSLLTLTYYGAEKWMPHYNVMGVAKAALEASVRYLAADLGPQGIRV
NAISAGPIKTLAASGIGDFRYILKWNEYNSPLRRTVTIEEVGETAAYLLSDMSRGVTGEI
HHVDAGYHVVGMKNPDAPDIVLGKE
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtccggcaagcgcgggctcatcatgggagtggccaacaaccgctccattgcctggggc
atcgccaaggccgcgcacgcccatggggccgaactcgccttcacctatcagggcgatgcg
ctgaagaagcgcgtcgagccgctggcggcggaactcggcgccggggtcgtcgggcattgc
gacgtcaccgacggggcgaccatcgacgccgtcttcgccgaggtggagaagcgctggggc
aagctcgacttcctcgtccacgccatcgccttctcggacaaggacgagctcaccggccgc
tatgtcgacacgacgccggagaacttctccaagagcctgctcatctcctgctactcgctg
acggccatcgcccagcgcgccgagaagctgatgaaggacggcggctcgctgctgacgctc
acctattacggcgccgagaagtggatgccgcactacaacgtcatgggcgtcgccaaggct
gcgctcgaggcgagcgtgcgctatctcgcggccgacctcggcccgcagggcatccgcgtc
aacgccatctcggccgggccgatcaagacgctcgcggcctccggcatcggcgacttccgc
tacatcctcaagtggaacgagtacaactcgccgctgcgccgcacggtgaccatcgaggaa
gtgggcgagacggccgcctatctcctgtccgacatgtcgcgcggcgtgaccggcgagatc
caccatgtcgacgccggctaccatgtcgtcggcatgaagaaccccgacgcgcccgacatc
gtgctcggcaaggaatga

DBGET integrated database retrieval system