KEGG   Chelatococcus sp. CO-6: AL346_18395Help
Entry
AL346_18395       CDS       T04040                                 

Definition
(GenBank) phosphoesterase
  KO
K00098  L-idonate 5-dehydrogenase [EC:1.1.1.264]
Organism
chel  Chelatococcus sp. CO-6
Brite
KEGG Orthology (KO) [BR:chel00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AL346_18395
Enzymes [BR:chel01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.264  L-idonate 5-dehydrogenase
     AL346_18395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C Methyltransf_25 Methyltransf_11 ThiF PrmA Viral_DNA_bp
Motif
Other DBs
NCBI-ProteinID: ALA19019
UniProt: A0A0K2DGQ7
LinkDB All DBs
Position
3925479..3926522
Genome map
AA seq 347 aa AA seqDB search
MRALVIHAPHDLRLESVPTAPLGPHDVLVRIAAGGICGSDLHYFHHGGFGTVRLKEPMVL
GHEVAGTIAAVGAAVTRVAPGDKVAVNPSAPCGHCRYCRMGLRNQCLDMRFYGSAMRFPH
VQGAFREEMVVPEGQAVKMAAGVDIALAAMCEPFAVALHAVAQAEDLAGKRVLVSGCGPI
GCLVIIAARRAAAGEIVATDIAPAALAIAGEVGASRLVDVSAGTAELADLAADKGQVDVV
LECSGNPQAIAGAIEVTRPGGTIVTVGLGGDVPLPMNAIVAKELLLRGSFRFDSEFDLAA
SLVSEGSVDLSPLLTATFPVEEAGAAFARASDRSRAMKVQIRFGDDI
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccctcgtcatccacgccccgcacgaccttcgcctcgaatccgtcccgacggcg
ccgctcggcccgcacgacgttctcgtgcggatcgcggccggcggcatctgcggctcggac
ctgcattattttcaccacggcggcttcggcaccgtgcgcctgaaggagccgatggtgctc
ggccacgaggtggccggcaccattgcggcggtcggggcggccgtgacccgcgtcgctccg
ggcgacaaggtcgccgtcaacccgagcgccccctgcggccattgccgctattgccggatg
ggccttcgcaaccagtgcctcgacatgcgcttctacggcagcgccatgcgctttccccac
gtgcagggcgccttccgcgaggagatggtggtgcccgaggggcaggccgtgaagatggcc
gcgggcgtcgacattgcgctcgccgccatgtgcgagccgttcgcggtggcgctgcatgcg
gtggcacaggccgaggacctcgccggcaagcgggttctcgtgtccggctgcgggccgatc
ggctgcctcgtgatcatcgccgcacggcgtgccgcggcgggtgagatcgtcgcgaccgac
atcgcgccggcggccctcgccatcgctggcgaagtcggggcgagccggctcgtcgacgtc
tccgccggcacggcggaactcgcggatcttgccgccgacaagggccaggtcgatgtcgtc
ctcgagtgctccggcaacccgcaagccattgcgggggccatcgaggttacccggcccggc
ggcacgatcgtgaccgttggtctcggcggtgacgttccgctgccaatgaatgcgatcgtc
gccaaggagctcctgctgcgcggcagcttccgcttcgacagcgagttcgatctcgccgcc
agtctcgtctcggaggggagcgtcgatctctccccgctgctcacggcgaccttcccggtc
gaggaagcaggcgccgccttcgcccgcgcctccgaccgcagccgcgcgatgaaggtgcag
atccgtttcggcgacgacatttga

DBGET integrated database retrieval system