KEGG   Chelatococcus sp. CO-6: AL346_22580Help
Entry
AL346_22580       CDS       T04040                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
chel  Chelatococcus sp. CO-6
Pathway
chel00010  Glycolysis / Gluconeogenesis
chel00620  Pyruvate metabolism
chel01100  Metabolic pathways
chel01110  Biosynthesis of secondary metabolites
chel01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:chel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AL346_22580
   00620 Pyruvate metabolism
    AL346_22580
Enzymes [BR:chel01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     AL346_22580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: ALA20216
UniProt: A0A0K2DJX5
LinkDB All DBs
Position
pCO-6:438305..439822
Genome map
AA seq 505 aa AA seqDB search
MNKVDVSRTARSPFAARYGNFINGTWVEPKAGRYFQNTSPVNGQPLCDIARSDAADIEAA
LDAAHAAKDTWGRTSAAGRAAVLNAIAQRMEDNLDLLARAETWDNGKPIRETTAADIPLA
IDHFRYFAGIVRAQEGSIGEIDHDTVAYHFHEPLGVVGQIIPWNFPILMAAWKLAPALAA
GNCVVLKPAEQTPASILVWAELVGDLLPPGVLNIVNGFGLEAGKPLASSPRIAKIAFTGE
TTTGRLIMQYASQNLIPVTLELGGKSPNIFFKDVLAEDDDFLDKAVEGFVMFALNQGEVC
TCPSRALVHEAIYDRFMEKALARVAAIVQGDPLDPATMIGAQASGEQLEKILSYIDIGRQ
EGAEVLAGGERNVLPGDLAGGYYVKPTVFRGHNRMRIFQEEIFGPVVSVTTFRDDEEALS
IANDTLYGLGAGIWTRDMYRAYRFGRSIEAGRVWTNCYHAYPAHAAFGGYKQSGIGRETH
KMMLDHYQQTKNMLVSYSPKKLGFF
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaggtcgatgtctcgcgcaccgcgcgctcgccgttcgccgcccgctacggcaat
ttcatcaacgggacctgggtcgagccgaaggccggccggtatttccagaacacctcgccg
gtgaacgggcagccgctctgcgacatcgcccgttcggacgcggcggatatcgaggccgcg
ctcgacgccgcccatgccgccaaggacacctggggacgcaccagcgccgccgggcgcgcc
gccgtcctcaatgccatcgcgcagcgcatggaggacaacctcgacctcctcgcgcgggcg
gagacctgggacaacggcaagccgatccgcgagacgacggcggccgacatcccgctcgcc
atcgaccacttccgctatttcgccggcatcgtccgcgcccaggagggctcgatcggcgag
atcgaccatgacacggtcgcctatcacttccacgagcccctcggcgtcgtcggccagatc
atcccgtggaacttccccatcctgatggcggcgtggaagctcgcgccggcgctcgcggcc
ggcaattgcgtggtgctgaagccggccgagcagacgccggcctccatcctcgtctgggcc
gagctcgtcggcgacctcctgccgccgggcgtgctcaacatcgtcaacggcttcggcctg
gaggccggcaagccgctcgcctcgagcccgcgcatcgccaagatcgccttcaccggcgag
acgacgaccggccggctcatcatgcaatatgccagccagaacctcatccccgtcacgctc
gagctcggcggcaagtcgccgaacatcttcttcaaggacgtgctcgccgaggacgacgac
ttcctcgacaaggcggtcgagggcttcgtcatgttcgcgctcaaccagggcgaggtctgc
acctgcccgagccgcgcgctggtgcacgaggcgatctacgaccgcttcatggagaaggcg
ctcgcgcgcgtcgcggcgatcgtgcagggcgacccgcttgacccggcgacgatgatcggc
gcgcaggcctccggcgagcagctcgagaagatcctgtcctatatcgacatcggccggcag
gagggcgccgaggtgctggcgggcggggagcgcaacgtgctgcccggcgacctcgccggc
ggctattacgtcaagcccacggtcttccgcggccacaaccgcatgcgcatcttccaggag
gagatcttcggcccggtcgtctccgtcaccaccttccgggacgacgaggaggcgctgtcg
atcgccaacgacacgctctacggcctcggcgccggcatctggacgcgcgacatgtaccgt
gcctatcgcttcggccgcagcatcgaggccggccgcgtgtggaccaactgctaccacgcc
tatccggcccacgccgccttcggcggctacaagcagtccggcatcgggcgcgagacgcac
aagatgatgctcgatcactaccagcagaccaagaacatgctggtgagctacagcccgaaa
aagctcggcttcttctga

DBGET integrated database retrieval system