KEGG   Chelatococcus sp. CO-6: AL346_23265Help
Entry
AL346_23265       CDS       T04040                                 

Definition
(GenBank) alpha-amylase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
chel  Chelatococcus sp. CO-6
Pathway
chel00500  Starch and sucrose metabolism
chel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:chel00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AL346_23265
Enzymes [BR:chel01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AL346_23265
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     AL346_23265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459 hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: ALA20336
UniProt: A0A0K2DKC6
LinkDB All DBs
Position
pCO-6:591507..594785
Genome map
AA seq 1092 aa AA seqDB search
MIDRSDPYWYRDAIIYQLHIKSFFDANNDGIGDFEGAIQKLDYIKDLGVTAIWLLPFYPS
PLRDDGYDIADYRGINPAYGTMRDFRRFVREAHERELRVITELVINHTSDQHPWFQRARR
ARPGSAWRDFYVWSDTDRKYRDARIIFLDTEPSNWSWDPVAKAYYWHRFFSHQPDLNFDN
PRVVEAVIDIMRFWLRTGVDGLRLDAIPYLIEREGTNCENLPETHAVLKRIRAALDAEFP
GRMLLAEANQWPEDTAPYFGEGDECHMAFHFPLMPRMYMGVAQEDRHPITDIVRQTPEIP
EGAQWAIFLRNHDELTLEMVTDQERDYLWSFYASDRQARINLGIRRRLAPLLGNDRRKIE
LLNSLLLSMPGTPVIYYGDEIGMGDNIYLGDRDGVRTPMQWSPDRNGGFSRADPARLFLP
PIQDPIYGFTAVNVEAQYRSLPSLLHWLRTLLSVRRTSQAFGRGSLRFLFPANRRVLAYL
RELDDERILCVANLSRAPQAVELELSEFVGYAPCEMTTGEQFPPFGELPYLLTLPAHSFF
WFKIVTVPAEEARFGPRPMHELFTLVMRGAAASLFDGRECSAFETNIAPPFLAGQRWFAS
VGGRPHVSLDDMAILQDGTGREAFPLALLSTSGRGQPPKRYFAPLSIEDHEAEPLMPYAL
ARVRRGARVGLLVDATATAEFPAAMLAAIERGERIPARKGEMRFTPMPQLAEFLARLPPE
DQLTPRRLGLEQSNTSIALDDKLVMKFYRQLQPGIHPELEVGRFLTEVGYRNTPGLLGTL
EYVEQDGTPTALAVLQLFVANQGDAWSWSLEALKRDLEHVALNKPLNGHPEAIAAGISAR
DLRGYLDLLGRRTAELHLALATPTEDPAFRTAPLAAEDVAAVADDALALAGRAFSALQEL
RSQAPERAREAIADLLARRGQAEALLQRSARIRPAGLCMRVHGDFHLGQVLISENDVVIV
DFEGEPARPADERRAKTSPLRDVAGMLRSFAYLADTAAEEVRQRFPDADRRIADVAEHKR
RLTQDVFLEAYAAAAAGHPLWIAEEERRLGLLRLFLLAKAFYEICYEAAHRPAWIGTPVR
GVLDLLRQGVGT
NT seq 3279 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaccgcagcgatccgtactggtaccgcgacgccatcatctaccagctgcacatc
aagtcgttcttcgacgccaacaacgacggcatcggcgacttcgaaggggccatccagaag
ctggactacatcaaggatctcggcgtcaccgccatctggctgctgccgttctatccctcc
ccgctgcgcgacgacggctacgacatcgccgactatcgcggcatcaacccggcctatggc
accatgcgcgacttccgccgcttcgtgcgcgaggcgcacgagcgcgagctcagggtcatc
accgaactcgtcatcaaccacacctcggaccagcatccgtggttccagcgggcgcggcgg
gcgcggcccggctcggcctggcgcgatttctatgtctggtccgacaccgaccggaaatat
cgcgacgcccgcatcatctttctcgacacggagccgtcgaactggtcgtgggatccggtc
gcgaaggcctattactggcaccgcttcttcagccaccagccggatctcaacttcgacaat
ccccgggtggtcgaggcggtcatcgacatcatgcgcttctggctgcgcacgggtgtcgac
ggcctcaggctcgacgccattccctatctcatcgagcgcgagggaacgaactgcgagaac
ctgccggagacccacgccgtcctcaagcgcatccgcgccgcgctcgatgccgaattcccc
ggccgcatgctgctcgccgaggcgaaccagtggccggaggacaccgccccctatttcggt
gagggcgacgaatgccacatggcctttcacttcccgctcatgccgcgcatgtacatgggc
gtggcgcaggaggatcgtcatcccatcaccgacatcgtgcgccagacgcccgagatcccc
gagggcgcccaatgggccatcttcctgcgcaatcacgacgagctgacgctcgagatggtc
accgaccaggagcgtgactatctctggtcgttctacgcctccgacaggcaggcacgcatc
aatctcggcatccggcgccggctcgcgccccttctcggcaacgaccggcgcaagatcgag
ctcctgaacagcctcctgctgtcgatgccgggcacgccggtcatctactatggcgacgag
atcggcatgggtgacaacatctatctcggcgaccgcgacggggtgcgcacgccgatgcaa
tggtcacccgaccgcaacggcggcttcagccgcgccgatccggcgaggctgttccttccg
ccgatccaggacccgatctacggcttcaccgccgtcaatgtggaggcccagtaccgcagc
ctcccgagcctgctgcactggctcaggacccttctgtcggtgcgccgcacctcccaggcc
ttcgggcgcggttcgctgcgcttcctgttcccggccaatcgccgcgtgctcgcctatctg
cgcgagctcgacgacgagcgcatcttgtgcgtcgccaatctctcgcgcgcaccgcaggcg
gtggagctggagttgtcggaattcgtcggctacgcgccctgcgagatgacgaccggcgag
cagtttccacccttcggcgagctgccctatctcctgacgctgccggcgcacagcttcttc
tggttcaagatcgtgaccgtgccggcggaggaggcgcgcttcgggccgcggccgatgcac
gaattgttcacgctcgtcatgcgcggcgcggcggcctccctcttcgacgggcgcgagtgc
agcgccttcgagaccaacatcgcgccgcccttcctcgcgggccagcgctggttcgcgtcg
gtcggcgggcggccgcacgtctccctcgacgacatggccatcctgcaggacggcacgggg
cgcgaggccttcccgctcgccctcctgtcgacgagtgggcgcggtcagccgcccaaacgc
tatttcgcaccgctctcgatcgaggatcacgaggcggagccgctcatgccctatgcgctc
gcgcgcgtgcggcggggcgcccgcgtcggactgctcgtcgacgcgacggccacggcggaa
ttcccggccgccatgctcgccgccatcgaacggggcgaacggatcccggccagaaagggg
gaaatgcgcttcacgcccatgccgcagctggcggagttcctcgcgcgccttccccctgag
gaccagctcacgccccggcgcctcgggctcgagcaatcgaacacgtccatcgcgctcgac
gacaagctggtcatgaagttctatcggcagctgcagccgggcattcatcccgagctcgaa
gtggggcgctttctgaccgaggtcggctaccgcaatacgcccgggctcctcggcacgctg
gaatatgtcgaacaggacggcacaccgacggcgctcgccgtcctgcagctcttcgtcgcc
aaccagggcgatgcctggtcctggtcgctggaagccctgaagcgggacctcgagcatgtc
gccctcaacaagccgctgaacggccatcccgaagcgatcgcggccgggatctcggcccgc
gacctgcggggctacctcgacctgctcgggcgccgcaccgccgaactgcaccttgccctc
gccacgccgacggaggatcccgccttccgcaccgcgccgctggcggccgaagacgttgcg
gccgtcgccgacgacgcgctcgcgctggcaggacgggctttcagcgccctgcaggaactc
cgttcgcaggcccccgaacgggcgcgggaagcgatcgcggacctgctcgcccgccgcggc
caggcggaagcactgctgcagcgcagcgcccgcatccggccggccgggctgtgcatgcgc
gtgcacggtgatttccatctcggccaggtgctcatctcggagaacgacgtcgtgatcgtc
gacttcgagggcgagcccgcgcggccggccgacgagcggcgtgccaagacctcgcccctg
cgcgacgtggccggcatgctgcggtcgttcgcctatctcgcggacacggccgccgaggag
gtccgccagcgtttccccgatgcggatcggcgcatcgcggacgtggcggagcacaagcgc
cggctgacgcaggacgtgttcctcgaggcctatgccgctgcggcggccggccatcccctg
tggatcgccgaggaggaacggcgcctcgggctgctgcgcctcttccttctcgccaaggcc
ttctacgagatctgctacgaggcggcgcaccgtccggcgtggatcggcacgccggtgcgc
ggcgtcctcgacctgttgcgccaaggagtggggacatga

DBGET integrated database retrieval system