KEGG   Candidatus Cardinium hertigii: DK880_00112Help
Entry
DK880_00112       CDS       T05479                                 

Gene name
ddlA_1
Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cher  Candidatus Cardinium hertigii
Pathway
cher00473  D-Alanine metabolism
cher00550  Peptidoglycan biosynthesis
cher01100  Metabolic pathways
cher01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cher00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    DK880_00112 (ddlA_1)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DK880_00112 (ddlA_1)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    DK880_00112 (ddlA_1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cher01011]
    DK880_00112 (ddlA_1)
Enzymes [BR:cher01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     DK880_00112 (ddlA_1)
Peptidoglycan biosynthesis and degradation proteins [BR:cher01011]
 Precursor biosynthesis
  Amino acid ligase
   DK880_00112 (ddlA_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_N Dala_Dala_lig_C ATP-grasp_4 ATP-grasp_3 ATPgrasp_ST TTL
Motif
Other DBs
NCBI-ProteinID: AWN81449
UniProt: A0A2Z3L7N0
LinkDB All DBs
Position
complement(127636..128934)
Genome map
AA seq 432 aa AA seqDB search
MNLENVRKRIAVLMGGYTAERHISLESGRNIYNKLAASAKYDVIPLFLSGSPEAQHIFTL
PTFLLLKDNADDIHNFLLHPTLWEDTLSLLDPIRAEAHALTDTYAKHSIHQPEILSYSAL
KKRVDFVFIALHGRPGEDGTLQRLLEQYAIPYNGSGIQTAALTIDKYATNQFLKQQGFHV
AQQVIITKQDWDASQTSVISSIERNLVYPLIVKPVDDGCSSGVRKITDRALLQDYITASF
NSSLKGTQPLGLSNDLPQSAQLLIENCIEQDPGILHLLEITVGLLTRIDANRATLYELFE
PSEVLAANTILTLEEKFLAGEGHNITPARFHKDPAIAKIISQMVQAELKKVAQKLNLQGY
ARIDAFVKIYPNQKIEVWIIEVNSLPAMTPATCIFHQCARNGYTPFHFIDAIIQYGFTKR
NFEKNTESVVYA
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgaaccttgaaaatgtgagaaaacgaatagctgttttaatgggaggatatacagctgaa
cggcatatatccctagagagtggaagaaatatctataacaagctagctgcttctgcaaaa
tatgatgtgattccgttatttttatctggttctcccgaagcgcagcatatttttacgcta
cctacttttcttctattaaaggataatgcggatgatattcataattttctattgcatcca
acgctatgggaagacacgctatctttattagatcctattagagcagaagcccatgcactg
actgatacctatgcgaagcatagtatccatcaaccagaaatacttagctattcagccctt
aaaaagcgtgtagattttgtttttatagctttacatggtagacctggagaagatggaacc
ttgcaaagattattggaacaatatgctattccctataatggatccggcatacaaactgct
gctttaaccattgacaaatatgcgaccaatcaatttttaaaacaacaaggttttcacgtt
gcccagcaagttattattacaaaacaagattgggatgctagccaaacttccgtaataagc
agtatcgagcgtaacttggtttatccacttattgttaagccagtagatgatggttgtagc
agtggggttaggaaaattacagatagggctctcttacaggattatataacggctagtttt
aatagctccttaaaaggaacccaaccattaggcttgtcaaatgatctgccccagtcagca
cagctgttaatagaaaattgtatagagcaagatccaggaatcttacacttattagaaata
acggtaggcttgttaacccgtatagacgccaatagagcaacactatatgaactatttgaa
ccttcggaagtattggctgctaacacgattcttacattggaagaaaaatttttagcagga
gaggggcataacattacccctgcccgttttcataaggatcctgccatagccaaaataata
agccaaatggttcaagcagagctaaaaaaagtagcccaaaagcttaaccttcaaggctat
gccagaatagatgcctttgtgaaaatatatcctaatcaaaagatagaagtatggattatt
gaagttaactcccttcctgctatgacacctgctacctgtattttccatcagtgtgcacgc
aatggctatacgccctttcattttatagatgccattattcaatatggttttacaaaaaga
aattttgaaaaaaatactgaatccgttgtatatgcttaa

DBGET integrated database retrieval system