KEGG   Capnocytophaga haemolytica: AXF12_11155Help
Entry
AXF12_11155       CDS       T04287                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase subunit E1
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
chg  Capnocytophaga haemolytica
Pathway
chg00020  Citrate cycle (TCA cycle)
chg00310  Lysine degradation
chg01100  Metabolic pathways
chg01110  Biosynthesis of secondary metabolites
chg01120  Microbial metabolism in diverse environments
chg01130  Biosynthesis of antibiotics
chg01200  Carbon metabolism
Module
chg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
chg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:chg00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AXF12_11155
  Amino acid metabolism
   00310 Lysine degradation
    AXF12_11155
   00380 Tryptophan metabolism
    AXF12_11155
Enzymes [BR:chg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     AXF12_11155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AMD86014
UniProt: A0A125S479
LinkDB All DBs
Position
complement(2534164..2537013)
Genome map
AA seq 949 aa AA seqDB search
MDKYSFLNAASTAFFGELYDKYCENPDAVEASWRAFFQGFDFAQEEYGAGSDTHEDRTPR
VVSELHKGAVPTQSVATSQAVVVAPEKVEKELKVLTLINGYRQWGHLFAPINPLRAREAY
TPDLSLEAYGLSEADLDTVFDCAKEIGLPASALRTIVERLKTLFCTAVATEYTYVRDPQE
RAWIEQRLQEDLERQFTKEEKIQILTKLNEATSFENFLHTKYVGQKRFSLEGNDTLIPAL
DFLIEEAGEKGVEHIVLGMAHRGRLNVLANIFDKNPQDIFSEFDGKDYEMDDTFDGDVKY
HLGVTTLKDTRKGKPMDLNLAPNPSHLEAVSPVVEGITRAKQDHYCADNFSKALPILLHG
DAAVSGQGIVYEVLQMCRLRGFQTGGTIHIVTNNQVGFTTNYTDSRSSTYCTDIAKSQDI
PVLHVNSDNAEAVVKTFLFALDYRQRFGKDIFIDLLGYRKYGHNEGDEPRFTQPKLYKLI
AKHPNPRDIYAKELMAQGVVDEAFVTQIENDYKSKLDNDLEVSRKYPMTIIKPFMLNEWG
GFELVAREVMLVSVNTSFDKEKLVEIAKLTTQLPEGKSFINKIKKVIADRREGILEKDAI
DWGGAEHLAYASLLAEGYDVRLTGEDVQRGTFSHRHAVVKTEDTEEEITPLYALKKVPEF
AKGTLHIYNSLLSEYGVLGYEYGYAMASPNTLTIWEAQFGDFANGAQIMMDQYISCGEDK
WKIQDGVVLLLPHGFEGQGSEHSSARVERYLQLCSDKNMFVANCTTPANFYHLLRRQMKA
LYRKPLVVFTPKSLLRHPQVVSTLDDLATGHFHEVIDDPIAEAAKVKTVVFCSGRFYYDL
YAEREKLGRDDVALVRLEQLFPLPIAQLKEVLAKYTNADDYVWAQEEPKNQGAYGYMLMN
FDLVNWRLASTPAYSAPASGSHTRDRKRHAEVVAMVFERGADARINRYY
NT seq 2850 nt NT seq  +upstreamnt  +downstreamnt
atggataagtattcttttttgaatgccgcaagtacggctttttttggtgaattatatgat
aaatattgtgaaaatcccgatgcagtagaggcaagttggcgcgccttttttcaggggttt
gactttgcccaagaagaatatggtgcgggcagtgatacacacgaggacagaaccccacgg
gtggtatcggagctgcacaagggtgctgtgcccacacaatcggttgctacctcacaagca
gtggtggttgcccccgagaaggtagagaaagaattgaaagttttgacccttatcaatggg
tatcggcagtgggggcatctctttgcacccattaatccgctacgcgcgcgcgaggcatat
acccccgatttgagccttgaggcttatgggctctcggaggctgatctggatacggttttt
gattgtgccaaggagatagggctgcctgcaagtgctttgcgcaccatcgttgagcggctt
aaaacgctcttttgcactgccgtagcaactgagtacacttatgtgcgcgaccctcaagag
cgcgcgtggatagaacagcgtttgcaagaggacctagagcggcaatttactaaggaagaa
aagatacagatacttaccaaactcaatgaagctacttcgtttgagaacttcctacatacg
aaatacgtagggcaaaagcgtttttcgcttgaggggaatgatacgcttatccctgcgctt
gacttcctcattgaggaggcgggtgagaaaggtgtggagcacattgtgttgggtatggca
caccgcgggcgactgaatgtgctcgcaaatatctttgacaagaaccctcaggatattttc
tccgagtttgatggaaaggattacgagatggacgacacttttgatggcgatgtgaagtat
cacttaggagtaacgaccttaaaggatacgcgcaagggcaagcctatggatttgaacttg
gcacccaatccatcacatttggaagcggtttcgcctgtggtagaagggattacgcgtgca
aagcaagaccactattgtgcggataatttttcaaaagcactgcctattcttttgcacggc
gatgcggcagtatcggggcagggcatcgtctacgaagtgttgcaaatgtgccgcctacgc
ggtttccaaacggggggtacgatccatatcgttacaaacaatcaagtgggctttaccact
aattacaccgattcgcgttcttctacctattgcacagatattgctaagtcgcaggatata
cctgtgctgcacgtcaatagtgataatgcagaggcggtggtaaagacctttctctttgcg
ttggattatcgccaaaggtttgggaaggatatatttatagacctcttgggctatcgcaaa
tatgggcataacgagggtgatgaaccgcgctttacgcaaccaaagctctataaactcatc
gctaagcatccgaatccgcgtgatatttatgccaaggagctgatggcacaaggggtggtt
gatgaggcgtttgttacccagatagagaatgactataaatcgaaattagacaacgattta
gaggtgtcgcgcaaatacccaatgaccatcatcaagccgtttatgctcaatgaatggggc
ggctttgagcttgtcgcacgggaggtaatgctcgtatcggtgaatacttcttttgacaag
gaaaagttagtagaaattgctaaactgaccacacagttgcctgagggaaagagttttatc
aataagataaagaaggtgattgctgaccgccgcgaaggtatccttgagaaggatgccatc
gattggggtggagcggaacacttggcgtacgcatcgctcttggctgagggttacgatgtg
cgcctgacaggtgaggatgtgcagcgcggtacgttctcgcatcgccacgcggtggtgaaa
acggaggatacagaggaggagattacacctttgtatgcattgaagaaggtgcctgagttc
gctaagggtacgttgcatatttacaattcgttactatcggaatacggtgtactgggctat
gagtacggctacgcgatggcaagccccaatacgctgacgatatgggaagcacagtttggc
gattttgccaatggggcgcagataatgatggatcagtacatctcgtgtggcgaggataag
tggaagatacaagacggggttgtgttgctattgccacacggctttgaggggcagggctct
gagcactcgtcggcgcgtgtggaacgctacttgcagctttgctcggataagaatatgttt
gtagctaattgtacgactcctgctaacttttatcacctattgcgccgtcagatgaaagca
ctttatcgtaagccgttggtggtatttacccctaagagtctgttgcgccatccacaggtg
gtttcaaccttggacgatctggcaacaggtcatttccacgaggtgattgacgaccctatt
gctgaggctgccaaagtaaagaccgtagtgttctgctctgggcgtttctattacgacctc
tatgcagagcgcgagaaactcgggcgtgatgatgtggcattggtacgccttgagcagctt
ttcccgttgccaatagcacaactcaaagaagtgctggcgaagtatacgaatgctgatgac
tatgtatgggcgcaagaagagcctaagaaccaaggggcttatggctatatgttgatgaat
tttgatttggtgaattggcgattggcatctacgcctgcttattcggctccagcctcagga
agccatacccgcgataggaagcgccacgcagaggtggtagcaatggtctttgaacgaggt
gcagatgcgaggatcaataggtattattga

DBGET integrated database retrieval system