KEGG   Chryseobacterium sp. IHB B 10212: A0O34_06805Help
Entry
A0O34_06805       CDS       T04575                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
chh  Chryseobacterium sp. IHB B 10212
Pathway
chh00564  Glycerophospholipid metabolism
chh01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:chh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    A0O34_06805
Enzymes [BR:chh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     A0O34_06805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored GIDA Pyr_redox_3 HI0933_like NAD_binding_8 Thi4 Pyr_redox_2 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ANF50243
UniProt: A0A172XTB3
LinkDB All DBs
Position
1520474..1522069
Genome map
AA seq 531 aa AA seqDB search
MKRNEELIKLANTQEWDFIVIGGGASGLGSALDATSRGFKTLLIESHDFAKATSSRSTKL
VHGGVRYLAQGDIGLVKEALKERGLLAQNAAHVVKNQSFIIPNYTWWGGIYYKIGLSIYD
FLAGKLSLGRTQYISKSKTVSKLPTIEQKNLMSGVVYQDGQFDDARLAINLAQTIIEKGG
SAINYLKVINLIKSDANKIIGVVAEDQFTQKRYEIHAKVVINATGIFTNDILNMNNPKHG
KFVVPSQGIHLVLDKSFLKSDDAIMIPKTSDGRVLFVVPWHDRALVGTTDTLLENESFEP
RALEEEINFVLNTARQYLSKKPTREDVKSVFAGLRPLAAPKDGSKSTKEVSRSHKVVTSD
TGLISIIGGKWTTYRKMAEDTINKAMEIHNLGMTTSKTEKLSIHGNVKAEQVDRSSHLYV
YGSDIPSIKMLQNSNPIYSEKIHPDQPFTVAEIVWAVRNEMAETIEDVLARRVRMLFLDA
RAAIDSAHKVSLIIAEERGLSAEWASQQEKEFIELAKGYLLIPYSPKNNQP
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaaatgaagaactcattaaattagccaatacccaggagtgggattttattgtt
attggtggtggagctagtggtttaggttctgcattggacgcaacaagcagaggatttaaa
actttactgatagaatctcacgattttgcaaaggcaacatccagcagaagtaccaaactt
gtacatggaggcgtaagatatcttgctcagggcgatatcggattggtaaaagaagcttta
aaagaaagaggcttgcttgcacaaaacgcagcacacgttgtaaaaaatcaatctttcatt
atccccaactatacttggtggggaggtatttattataaaataggattatctatctatgat
tttcttgccgggaaattaagccttggaagaacacaatatataagtaagtctaaaactgtc
agcaaacttccaacgattgagcagaaaaacctcatgagtggtgttgtttatcaagacgga
caatttgacgatgcacgtttagcgattaatttagctcaaaccattattgaaaaaggagga
agtgctattaattatttaaaagtaatcaatcttattaaaagtgatgctaataaaataatc
ggagttgttgcagaagatcagttcactcaaaaacgatatgaaattcatgcaaaggttgtc
atcaacgcgacaggaattttcacgaatgacatccttaatatgaataatccaaagcacgga
aaatttgttgttccaagtcagggtattcatttggttttagataaatctttcttaaaaagc
gatgacgccatcatgattccaaaaacgtcagacggaagagttttgtttgtcgttccgtgg
cacgacagagctttagttggaacaaccgatactttattagaaaacgaaagttttgaacca
agagctttggaagaagaaattaatttcgttttaaatacagcaagacaatatctttctaaa
aaaccaacacgtgaagatgtaaaatctgtttttgcaggattaagaccgcttgccgctcca
aaagacggaagcaaaagcactaaagaagtatccagaagtcataaagtggttacgtctgat
accggattgatttcaatcatcggtggaaaatggacgacctaccgtaaaatggcagaagac
accattaacaaagccatggaaattcacaatctgggaatgacaacttctaaaacagagaaa
ttatccattcatggtaatgtaaaagctgagcaggtagacagaagcagtcatttatatgtt
tacggttcagatattccttcaataaaaatgttgcaaaacagcaatcctatatattcagaa
aagattcatccggatcaacctttcacagttgcagaaatagtctgggcagtaagaaatgaa
atggcggaaacaatagaagatgttttagcaagaagagtccgcatgttattcttagatgca
agagcagcgatcgacagtgcacataaagtatcgttgatcattgcagaagaaagaggactt
tcagcagaatgggcaagccaacaggaaaaagaattcattgaattagcaaaaggttattta
ttaataccctactctcctaaaaacaatcaaccataa

DBGET integrated database retrieval system