KEGG   Cardiobacterium hominis: NCTC10426_00290Help
Entry
NCTC10426_00290   CDS       T05791                                 

Gene name
folP
Definition
(GenBank) Dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
chj  Cardiobacterium hominis
Pathway
chj00790  Folate biosynthesis
chj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:chj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NCTC10426_00290 (folP)
Enzymes [BR:chj01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     NCTC10426_00290 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: VEG76276
LinkDB All DBs
Position
1:330385..331215
Genome map
AA seq 276 aa AA seqDB search
MRCGRFTLDLSHTNLMGVLNSTPDSFSDGGAWLDPARAIAHARHMIAAGADILDIGAEST
RPGAREVPADEEIARLTPIVQALVADGQRPVSIDSKKTAVMAAMLELGVDLINDVHGLED
DGALALLARYPNVAICLMHMRGMPDTMQDNTDYADVVAEVDAYLQARVAACLAAGIAAER
LILDPGFGFGKTPAQNMALVRECRRFKHGRYPVLLGVSRKSTIGHYLGDAPVGERLHGSV
TLAALAAWQGADIVRVHDVAATRDALRITTALRAPG
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgcgttgcggccgcttcacgctcgacctgagccataccaacctgatgggcgtgctgaac
agcacgcccgattcattttccgacggcggcgcctggcttgacccagcccgcgccatcgcc
cacgcgcgacacatgattgccgcaggcgcggacattctcgacatcggcgccgaatccacc
cgtcccggcgcgcgcgaagtcccggcagacgaagaaatcgcccgcctcacccccatcgtg
caagcgctggttgccgacggccagcgccccgtctccatcgacagcaaaaaaaccgcggtg
atggcggcgatgctcgaactgggcgtggacctcatcaacgacgtccacggcctcgaagac
gacggcgcgctggcgctgctcgcccgctacccgaacgtcgccatctgcctgatgcacatg
cgcggcatgcccgacaccatgcaggacaacaccgactacgccgacgtcgtcgccgaagtg
gatgcctacctgcaagcgcgcgtcgccgcctgccttgcggcggggatcgccgccgagcgc
ctcatcctcgaccccggctttggctttggcaaaaccccggcgcaaaacatggcgctggta
cgcgaatgccgccgcttcaaacacggacgttacccggtgctgcttggcgtctcgcgcaaa
tccaccatcggccactaccttggcgacgccccggttggcgaacgcctgcacggcagcgta
accctcgccgcgctcgccgcctggcagggcgcggacatcgtgcgcgtccacgacgtcgcc
gccacccgcgacgccttgcgcatcaccactgccttgcgcgcgccgggctaa

DBGET integrated database retrieval system