KEGG   Cardiobacterium hominis: NCTC10426_02136Help
Entry
NCTC10426_02136   CDS       T05791                                 

Gene name
glpD
Definition
(GenBank) Aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
chj  Cardiobacterium hominis
Pathway
chj00564  Glycerophospholipid metabolism
chj01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:chj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    NCTC10426_02136 (glpD)
Enzymes [BR:chj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     NCTC10426_02136 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 NAD_binding_8 Pyr_redox_2 HI0933_like GIDA FAD_binding_3 Pyr_redox_3 Thi4 Lycopene_cycl 3HCDH_N Pyr_redox
Motif
Other DBs
NCBI-ProteinID: VEG78075
LinkDB All DBs
Position
1:2254668..2256224
Genome map
AA seq 518 aa AA seqDB search
MKRQENLERAKSSETWDVVVIGGGATGLGIAVDAATRGFSTLLLERRDFAKGTSSRSTKL
VHGGVRYLAQGYVDLVREALRERGRLAKNAPHLFKSEAFIIPGEKWWTAPYYTFGLWLYD
RLAGKLGIGHTRYLGKGEANKLLQGVKPEKLRNGVCYYDGQFDDSRLAVNLAQTAIEHGA
AVVNYCEVIGLEKNEAGKICGVKIRDNLGGDEFTAKARCVVNATGVFANEINKMDDPNAL
DGIVPSQGVHIVIDRKFLPGDSALMVPKTSDGRVLFAVPWHDKLVVGTTDTLVKDAEYEP
RPLEQEVEFILNTAKDYLVKAPTRADIRSVFVGLRPLAAPKDSGKSTKEVSRSHKVHVTP
SGMVDIIGGKWTTYRQMAEDAVDAAIKDKTLPEKPCQTTELKIHGHAPADMSHHLGYYGS
DRPAIEALAQADAKAGSKIHPDHPFLYAEALWAVREEMAQTLEDVLARRIRLLFLDARAA
AEVAEDVARYIAAELGKDENWVREQTEDFRKLCAQYHF
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagacaagagaatctcgaacgcgccaaaagttcagaaacatgggacgtcgtcgtc
atcggcggcggcgcgaccggccttggcatcgcggtagatgccgccacgcgcggattctcg
accctgctgctggaacgccgcgatttcgccaaaggcacctccagccgcagcaccaaactc
gtccacggtggcgtgcgctacctcgcccaaggctacgtggacctcgtgcgcgaagccctg
cgcgaacgcggacggctcgcgaaaaacgcgccgcacctcttcaaaagcgaagcctttatc
atccctggcgaaaaatggtggacggcgccttactacaccttcggcctctggctctatgac
cgcctcgccggcaaactcggcatcggccacacccgctacctcggcaagggcgaagccaac
aaactgcttcaaggcgtcaagccggaaaaactgcgcaacggcgtctgctactacgacggc
cagttcgacgactcccgcctcgcggtaaacctcgcacaaaccgccatcgaacacggcgcc
gccgtggtgaactactgcgaagtcatcggtctggaaaaaaacgaagcgggcaaaatttgc
ggcgtcaaaatccgcgacaacctcggcggtgacgaatttacggcgaaagcgcgctgcgtc
gtcaatgcgaccggggtgtttgccaacgaaatcaacaaaatggacgacccgaacgcgctg
gacggcatcgtgccgagccagggcgtacacatcgtcatcgaccgcaaattcctgccgggc
gactccgcgctgatggtgccgaaaacctctgacggccgcgtgctgttcgccgtaccgtgg
cacgacaaactcgtcgtcggcaccaccgacaccctcgtcaaagacgccgaatacgaaccg
cgcccgctggagcaggaagtcgaattcatcctgaacaccgccaaagactacctcgtcaaa
gcgccgacccgcgcagatatccgcagcgtcttcgtcggcctgcgtccgctcgccgcgccc
aaagacagcggcaaaagcaccaaagaagtctcacgcagccacaaagtgcacgtcaccccg
tccggcatggtggacatcatcggcggcaaatggacgacctaccggcaaatggctgaagac
gcggttgatgccgctatcaaagacaaaaccctgccggaaaaaccctgccagaccaccgaa
ctcaaaatccacggccacgcacccgcggacatgagccaccacctcggctactacggcagc
gaccgcccggcgatagaagcacttgcccaggcagacgccaaagcgggcagcaaaatccac
cctgaccaccccttcctctacgccgaagcgctatgggcggtgcgcgaagaaatggcacag
acgctggaagacgtactcgcccgccgcatccgcctgctcttcctcgatgcccgcgccgca
gccgaagtagcggaagacgtcgcgcgctacatcgccgccgagctgggcaaagacgaaaac
tgggtacgcgaacaaacggaagacttccgcaaactctgcgcgcagtatcacttctaa

DBGET integrated database retrieval system