KEGG   Cardiobacterium hominis: NCTC10426_02322Help
Entry
NCTC10426_02322   CDS       T05791                                 

Gene name
ahpF
Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
chj  Cardiobacterium hominis
Brite
KEGG Orthology (KO) [BR:chj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    NCTC10426_02322 (ahpF)
Enzymes [BR:chj01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     NCTC10426_02322 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA HI0933_like Thioredoxin_3 FAD_oxidored FAD_binding_2 DAO Thi4 NAD_binding_8 AlaDh_PNT_C Lycopene_cycl NAD_binding_7 FAD_binding_3 3HCDH_N K_oxygenase Trp_halogenase
Motif
Other DBs
NCBI-ProteinID: VEG78256
LinkDB All DBs
Position
1:complement(2481715..2483277)
Genome map
AA seq 520 aa AA seqDB search
MQLDQAMLDTVRQYFAALSRDITLVLAAGNHAKRDELKTFLAQIVATSPRLSLIEQADAA
LTSPVSFKLLADGTDTGIIFSGIPGGHEFSSLILAILQAGGSALKLDESIQTLIRAVRQP
LAFSTYISLSCHNCPDVVQTLNQFALLNPAISSEMIDGGLFQEQIEAKNIQGVPAVYLNG
EAFANGKIDTARLVEKLLERYPDLASAAAPAKSLPLQDVVVIGGGPAGSSAAIYAARKGL
KVTLVADRIGGQVKDTMDIENLISVPKTTGPELAGKLHTHLAAYPITLRENLRVQSVEKG
GATHKVLLNTGETIETRTLIVASGAKWRELGIPGEKENIGNGVAFCPHCDGPFFKDKDIA
VIGGGNSGVEAALDLAGIVKSVTVLEFMPELKADKVLVEQLGKRDNIHVITNAAAQAIDT
ENGKVSRLRYTDRTTDTAQTLALQGIFVQIGLVPNSDFLGDVVERTRFGEIVINAKGETS
TPGIFAAGDVTTVPYKQIIVAMGEGAKAALSAFDYLIRQQ
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgcaactcgaccaagccatgctggacaccgtccgccaatacttcgccgcccttagccgc
gacatcaccctcgtcctcgccgcaggcaaccacgctaagcgcgacgaactgaaaaccttc
ctcgcgcaaatcgtcgccacctcgccgcgtctctcgctcatcgagcaagcagacgccgcg
ctcacctcgccggtcagcttcaaactgctcgccgacggcacggataccggcattatcttc
agcggtatccccggcggccacgaattcagctcgctcattctcgccatcctgcaagcgggc
ggcagcgcgctcaagctcgatgagagcatccagaccctcatccgcgccgtgcgtcagccg
ctcgccttcagcacttacatctcgctctcctgccacaactgcccggacgtggtgcaaacg
ctgaaccagtttgccctgctgaaccccgctataagcagcgaaatgattgacggcggtctc
tttcaggaacaaatagaagcgaaaaacatccagggcgtaccggcggtctatctcaacggc
gaagccttcgccaacggcaaaatcgacaccgcccgcctcgtcgaaaaactcttggaacgc
taccctgaccttgccagcgccgccgcacccgccaaaagcctgccgctgcaagacgtggtc
gtcatcggcggcggccccgccggctcatcagcggccatctacgcggcgcgcaaagggctg
aaagtcaccctcgttgccgaccgcatcggcggtcaggtgaaagacacgatggacatcgaa
aacctcatctccgtgccgaaaaccaccggcccggaactggcgggcaaactgcacacccac
cttgccgcctacccgattaccctccgcgaaaacctgcgcgtgcaaagcgtggaaaaaggc
ggagcgacgcacaaagtgctgctcaacaccggcgagacgattgagacccgcacgctcatc
gtcgccagcggtgccaaatggcgcgagcttggcatccccggcgaaaaagaaaacatcggc
aacggcgtcgccttctgcccgcactgcgacggcccgttcttcaaggacaaagacatcgcg
gtcatcggcggcggtaacagcggcgttgaagcggcgctggatctcgccggcatcgtcaaa
agcgttaccgtgctggaattcatgccggagctgaaagcggacaaagtgctggttgagcaa
ctgggcaaacgtgacaacatccacgtcatcaccaacgccgccgcgcaggcgattgacaca
gaaaacggcaaagtgagccgcctgcgctataccgaccgcacgaccgacaccgcgcaaaca
ctggcgctgcaaggcattttcgtacaaatcggcctggtgccgaacagcgactttttgggc
gacgtggtggagcgcacccgcttcggcgaaatcgtcatcaacgccaagggcgagaccagc
acgccgggcatcttcgccgccggtgatgtgacgaccgtgccgtacaaacaaatcatcgtg
gcgatgggcgagggggccaaagcggcgctctccgccttcgactatttgattcgccagcaa
taa

DBGET integrated database retrieval system