KEGG   Chryseolinea sp. KIS68-18: D4L85_04315Help
Entry
D4L85_04315       CDS       T05641                                 

Gene name
ligD
Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
chk  Chryseolinea sp. KIS68-18
Pathway
chk03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:chk00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    D4L85_04315 (ligD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:chk03400]
    D4L85_04315 (ligD)
Enzymes [BR:chk01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     D4L85_04315 (ligD)
DNA repair and recombination proteins [BR:chk03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     D4L85_04315 (ligD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme DNA_ligase_OB_2 B5
Motif
Other DBs
NCBI-ProteinID: AYB35406
UniProt: A0A385SXM7
LinkDB All DBs
Position
1041704..1043626
Genome map
AA seq 640 aa AA seqDB search
MLAQIGDKPFDDNGWLFEVKWDGYRAVAEVNKNDVRLYSRNGLSFLDLYAPVAQELKKIK
DDVMLDGEIVVLDDHSKPSFQKLQHYDENRNRPLVYYVFDCLRYKNKDLTHLPLEERKKI
LEKLLPKSNIIRYSDHVENEGTAFFHKVSEMGLEGMIAKRKNSTYTEGKRSNDWLKIKNQ
NTQEAIIAGFTEPRNSRSYFGALILGMYEKGQLKYIGHTGTGFTEKVLKEIHNLLKPLVR
ETSPFEEHVPVNSPVTWVEPVKVCQVKFTEITDDGILRHPVFMGLRIDKAARDVDHVDVK
KPNPKAVDKKTSPSQKNVSRKSTPKKLPSGKDATAEEPKDGVIKRVDGHELRLTHQGKVY
WPKRGITKGDVIAYYETIYPYIIPYLKDRPESLKRNPNGIENKGFFHKDAGQAAPSWVKH
IPLYSESSKKEVDYILCNDKATLLYLNNLGCIEINPWNSRVKNLDKPDYLVLDIDPSEKN
TFDEVIEAALAIKEVLDKAGANGYCKTSGASGLHIYVPLHAQYDYDHARDFAEIVARLAG
EKLPRITTLERSLSKRKNRIYLDYLQNSKGQTLASAYSLRPVEDATVSTPLTWKEVKPGL
HPSQFTITTLAKRLTKTGDLFAGVLKEKTNLNACLKKLGA
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgctggcgcagatcggcgataagccgtttgacgacaacggctggctgtttgaagtgaag
tgggacggctatcgcgccgtggccgaggtgaacaagaacgacgtgcgtctgtattcgcgg
aacggcctttccttcctggacctctatgcacccgtcgcccaggaattgaagaaaataaaa
gacgacgtgatgctcgacggcgaaatcgtggtgctggacgatcacagcaaacccagtttt
caaaaattgcaacactacgacgagaatcgcaaccggccgctggtgtattacgtttttgat
tgtcttcgctataaaaacaaagacctcacccatcttccccttgaggagcgcaagaagatc
ctggaaaaattgctgcccaaaagcaacatcatccgttattccgatcatgttgaaaatgaa
ggcaccgcttttttccacaaagtctcggaaatgggactcgaaggcatgatcgccaaaagg
aagaacagcacctatacagaaggaaaacgttcgaatgactggctgaagataaaaaatcaa
aacacgcaagaagccatcattgcgggcttcacggagccgcgcaacagccgcagttatttt
ggcgcgcttattttaggcatgtatgagaaagggcagttgaaatacatcggtcacaccgga
accgggttcacggagaaagtattgaaagagatccacaacctcctgaaacctcttgttcgc
gaaacctcgcctttcgaggaacacgtgccggtgaactcgcccgtgacctgggttgagccc
gtgaaagtgtgccaggtaaaatttaccgagatcaccgacgacggcattttgcgtcacccc
gtctttatggggttgcgcatcgacaaagcagcccgggatgtcgatcacgtcgacgtgaag
aaaccaaacccaaaagccgtggataaaaaaaccagcccatcgcaaaagaacgtctcccga
aagagcacaccaaaaaaacttccctccggcaaggatgcgacagcggaggagccaaaagac
ggtgtcatcaaacgtgttgacggccacgagcttcgtctcacgcatcaaggcaaagtgtat
tggcccaagcgcggcatcactaaaggggatgtcattgcctattacgaaacgatctatccc
tacatcattccctatctgaaagacagaccggagtcgttgaagcgaaatccgaatggcatc
gagaacaagggatttttccacaaagacgccgggcaagccgctccatcgtgggtgaagcac
atcccgctatactcggagagctccaaaaaagaggttgactacattctctgcaacgacaag
gctacactgctctatttaaacaacctcggttgcatcgagatcaacccctggaattcgcgg
gtgaaaaacctcgacaaaccggactatctcgtgctggacatcgacccttcggagaaaaat
acattcgatgaagtgatcgaggcagcgctggccatcaaagaagtgctggataaggctgga
gccaacgggtattgcaaaacttcgggggcttcgggattgcatatctatgttcccctgcat
gcgcagtatgactacgatcacgcgcgcgactttgcagagatcgttgcccggcttgcagga
gagaaactaccccgcatcaccacgctcgagcgttcgctatcaaaaagaaaaaatcgcatc
tacctcgattatctccaaaacagcaagggccagaccttggcttcggcctacagtcttcgc
ccggtggaagacgccacggtctctactcccctgacctggaaagaagtgaagccgggattg
caccccagccagttcaccatcaccacccttgccaagagactcaccaagaccggtgacctc
tttgcgggcgtgctcaaggaaaaaacaaatctcaacgcttgtctaaaaaaattgggggca
tga

DBGET integrated database retrieval system