KEGG   Chryseolinea sp. KIS68-18: D4L85_06705Help
Entry
D4L85_06705       CDS       T05641                                 

Gene name
kynU
Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
chk  Chryseolinea sp. KIS68-18
Pathway
chk00380  Tryptophan metabolism
chk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:chk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    D4L85_06705 (kynU)
Enzymes [BR:chk01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     D4L85_06705 (kynU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AYB30298
UniProt: A0A385SMS7
LinkDB All DBs
Position
1576029..1577297
Genome map
AA seq 422 aa AA seqDB search
MTFENTHHFAKAMDRQDPLRSFRSKFHIPTVHGKTALYFTGNSLGLQPKTTKRFLLEELE
DWAALGVEGHVHARRPWMYYHKLTKKALASVVGAKPSEVVAMNQLTVNLHLMLISFYTPT
PQRYKILTESGAFSSDQYAFESQLKFHGLDPDKALVELKPREGEYTLRTDDILAAIETHR
DELALVIFGGVQYYTGQFFDIPRITQAGKRAGACVGFDLAHAVGNVPLSLHKHDVDFAVW
CSYKYLNSGPGAIAGAFIHERHSKKFTGPRLAGWWGQVEKERFQMLKGFKPMEGIDGWQL
SNVPIFQSAAHLAALEIFQDAGMKAVRAKSILLTGYLEFLLKEMDAGEKYFTLLTPSSPD
ERGAQLSLLMKKDGKKIFKALTKAGAIVDWREPDVIRLAPAPLYNSFEDVFQLGLLFKKA
LK
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgactttcgaaaacacacatcattttgccaaggctatggatcgccaggacccgctgcgg
tcgttccggtccaagttccacattcccacggtacatgggaagaccgcgctgtattttaca
ggcaattctttgggtcttcaacccaagaccacgaaacgattcctactggaggagctggaa
gactgggccgcactaggagtggaaggacatgtgcacgcgcgtcgtccctggatgtattat
cataagctcaccaaaaaagcgctcgcatcggtagtgggcgcaaagccgtcggaagtggtg
gccatgaatcagctcacggtgaatctgcacctcatgctgatctcgttctacacgcccacg
ccccaacgctacaagatcctgaccgagagcggcgcgttttcttccgaccaatacgctttc
gaatcgcagctcaaatttcacggactcgatccggataaagcactggtggaattgaaaccc
cgcgaaggcgaatacaccttgcgcaccgacgacatcctcgcggccatagaaacacatcgc
gacgaactggcgctggtcatcttcggtggcgtgcaatattatacggggcaattttttgac
atcccgcgcatcacacaggcaggtaagcgggccggcgcttgtgtgggatttgatctggcg
catgctgtcggcaacgttccgttgtcgctacacaaacacgatgtcgattttgctgtgtgg
tgcagctacaaatatttgaactccggtccgggtgcgattgcgggggcattcatacacgag
cgccactcaaaaaaattcaccggcccgcgtcttgccgggtggtggggccaggtggagaaa
gaacggttccagatgttgaagggctttaagccgatggaaggcatcgatggctggcaactc
tccaatgttcccatttttcaaagcgcagcgcatctggccgcattggaaattttccaggat
gccggcatgaaagctgtgcgcgcaaaaagcattttgctgaccgggtatctggaattcctg
ttgaaggaaatggatgccggtgaaaaatatttcaccctcctcaccccttcatcacccgac
gaacgcggtgcacaactttcgttgctgatgaagaaggacggcaaaaaaatattcaaggcc
ctcacgaaagctggtgcgatcgtagactggcgcgaacccgatgtgatccggctcgcacct
gcaccgttatacaactcgtttgaggacgtgttccaattaggactcctgttcaagaaagca
ctgaagtga

DBGET integrated database retrieval system