KEGG   Chryseolinea sp. KIS68-18: D4L85_11275Help
Entry
D4L85_11275       CDS       T05641                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
chk  Chryseolinea sp. KIS68-18
Pathway
chk00620  Pyruvate metabolism
chk00680  Methane metabolism
chk01100  Metabolic pathways
chk01120  Microbial metabolism in diverse environments
chk01200  Carbon metabolism
Module
chk_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:chk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    D4L85_11275
  09102 Energy metabolism
   00680 Methane metabolism
    D4L85_11275
Enzymes [BR:chk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     D4L85_11275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AYB31120
UniProt: A0A385SNT4
LinkDB All DBs
Position
complement(2598515..2601082)
Genome map
AA seq 855 aa AA seqDB search
MASQFNEAVSTRYHMYNSLFLNLPYTGIYRTGTLLPLLQQACETDYEKGKDPKTIIKKFF
ANYTPQATREEQFNLLFNFIQYIERQVVLFDSVEDSAFAEINDLKGKGSVSELLLRATAE
NLLDDLKKRLEDFSVRIVLTAHPTQFYPGNVLAILNDLEQAIHENRLEHINLLLRQLGKT
AFINKEKPTPFDEAVSLSWFLENVFYNVIPDIITQLMNGLNMKLEEWTNYDLIKIGFWPG
GDRDGNPFVTHEITVKVAQNLQQTLMKCYYRDIRFLKRRLTFKGLDHIIARAERKIYPMA
FGGGFGGEIYSHPDELLNDLFEVREVLIRDHKGLFLNLLDDFILKVRIFGFYFASMDIRQ
DSRKHAYAWEAMLEKLKPKNKALKNFDKLSEEEKIETLLGLSFKPTSMKFEDTFISELIE
SIDIIGQIQEDNGVEGCHRYVISNCQSALDVIRVYQLANLILGKNDELALDIVPLFETIE
DLAHAPGIMAKLYSVEAYREHLKRRGGKQTIMLGFSDGTKDGGYLRANWSIFQAKEHLTR
ITRDNGFTAVFFDGRGGPPARGGGNTHDFYASLGDTIEDKEVQITIQGQTISSNFGKPVS
CGYNIEQLLSAGIENSVFKKKHQFKEDETSLMNALAEEGHKAYLDLKKHPKFVPYLEKIT
PLSFFGDINIGSRPVKRNSGSLKFEDLRAIPFVGSWAQMKQNIPGFYGVGTALKELKKQG
KFRELKNLFNESLFFRTLLSNSMMSLTKTYYPATAYLAKDKEFSEFWKKMHAEYKLSAQM
ILEVSGLPGLMDNTPMNRDSVKLRERIVLPMITIQQFALQQLRHLEAADKPFEKQYRSLV
VRCMFGIINAARNSA
NT seq 2568 nt NT seq  +upstreamnt  +downstreamnt
atggcaagtcaattcaacgaggctgtttcaacacgttatcacatgtataacagccttttt
ctcaatcttccctatacgggcatctaccgaaccgggaccttacttcccctgctgcagcaa
gcctgcgaaaccgactatgaaaagggtaaggatccaaagaccatcatcaagaaatttttc
gccaactatacgccccaggctacccgcgaagagcagttcaacctgctgttcaatttcatt
caatacatcgagcgccaggtggtgttgttcgactccgtggaagattccgctttcgcggaa
atcaacgacctgaagggtaagggaagcgtttcggaactgttgctccgcgccacggccgaa
aacctcctcgatgatttgaaaaaacggctggaggatttcagcgtgcgcatcgtgctcacg
gcccaccctacccagttctaccccggcaacgtgctggccatcctcaacgacctggagcag
gccatccacgaaaaccggctggagcacatcaacctgttgctgcgccaactgggaaaaacc
gcgttcatcaacaaagaaaaacccacgcccttcgacgaggcagtgagcctgtcgtggttc
ctggaaaatgttttctacaacgtcatccccgatatcatcacccaactgatgaacgggctg
aacatgaagttggaggagtggaccaactacgacctgatcaagatcggcttctggcccggc
ggcgaccgcgacggcaacccgtttgttacgcacgagatcacggtgaaggtggcccaaaac
cttcagcaaaccctgatgaagtgctactaccgcgacatccggttcctgaagcgccgcctc
acattcaaaggacttgaccacatcattgcccgcgccgagcgcaaaatatatcccatggcc
tttggcggtggtttcggaggcgagatctacagccaccccgatgaactgctgaacgacctg
ttcgaagttcgcgaggtattgatccgcgaccacaagggactgttcctgaacctgctcgac
gacttcattctgaaggtgcggatcttcggcttctatttcgccagcatggacattcgccag
gacagccgcaaacacgcctatgcctgggaagcgatgctcgaaaaactgaaacccaaaaac
aaagccctcaaaaacttcgacaagctttcggaagaagagaagatcgagacactgctcggc
ctttctttcaagcccacctctatgaagttcgaggacacatttatcagcgagctcatcgaa
agcatcgacatcatcggccagatccaggaagacaatggcgtggagggctgtcaccgctac
gtgatcagcaactgccagtcggcgctggacgtgatccgcgtctatcaactggccaacctg
atcctgggcaagaacgacgagctggccctcgacatcgtgcccctgttcgagaccatcgag
gacctggcccatgccccgggcatcatggccaaactctatagcgtggaagcctaccgcgag
cacctgaagcgccgcggtggcaagcagaccatcatgttaggcttctccgatggcaccaaa
gacggcggctacctgcgcgccaactggtccatcttccaggccaaagaacacctgacacgc
atcacgcgcgacaacggcttcaccgccgtgttcttcgacggccgtggcggcccgcccgcc
cgcggcggcggcaacacccacgacttctatgcctcgctgggcgacaccatcgaagacaag
gaggtgcagatcactatccagggacagaccatcagctcgaactttggcaagccggtttcg
tgcggctataacatcgaacagcttttgtcggccggcatcgagaactccgtgttcaaaaag
aaacaccagttcaaggaagacgagaccagccttatgaacgctttggcggaagaaggtcac
aaggcctatctcgacttgaagaaacatccgaagtttgttccttacctggaaaagatcacg
ccgctttcgttctttggcgatatcaacatcgggtcgcgtcccgtgaaacgcaattccgga
agtttgaaatttgaagacttgcgcgccattccttttgtgggctcatgggcgcagatgaag
caaaacattcccggtttttatggcgtgggtaccgcgctgaaagaattgaagaagcaaggc
aagtttcgcgagttgaaaaatcttttcaacgagtcgctattcttccgcacgctgttgagc
aacagtatgatgtcgctcaccaaaacgtattatcccgccacggcctacctggccaaggac
aaagagtttagcgagttctggaaaaagatgcacgccgaatacaagctctccgcccagatg
atcctggaagtgtcgggacttccggggttaatggataacacgcctatgaaccgcgattcg
gtgaaattgcgcgagcgcatcgtgttgcccatgatcaccatccagcaattcgcgttacag
caattgcgccacctggaggctgcggataagccttttgaaaaacaataccggtcgctggtg
gtgcggtgtatgtttggtattatcaacgctgcgcggaattcagcgtaa

DBGET integrated database retrieval system