KEGG   Chryseolinea sp. KIS68-18: D4L85_28090Help
Entry
D4L85_28090       CDS       T05641                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
chk  Chryseolinea sp. KIS68-18
Pathway
chk00473  D-Alanine metabolism
chk00550  Peptidoglycan biosynthesis
chk01100  Metabolic pathways
chk01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:chk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    D4L85_28090
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    D4L85_28090
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    D4L85_28090
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:chk01011]
    D4L85_28090
Enzymes [BR:chk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     D4L85_28090
Peptidoglycan biosynthesis and degradation proteins [BR:chk01011]
 Precursor biosynthesis
  Amino acid ligase
   D4L85_28090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 GARS_A Ntox33 ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: AYB34205
UniProt: A0A385SW63
LinkDB All DBs
Position
6735001..6736086
Genome map
AA seq 361 aa AA seqDB search
MPKKKKVAILYGGRSVEHAVSVNSARNIFEFLDKSKFEPLPIGISKSGQWFLTEGVSKDI
QKGQTLGLSLNAGKPTFLLEKSGEKFSVDVLFPVLHGTDGEDGSIQGLIKAMDLPMVGTG
VLGSSLSMNKIVAKRLMREAGLPVTDFVTFRYDEKDKISFTALSKKLGLPFMVKAASLGS
SVGVAKVKSKKDFAAAVEEAFKYDDEMLAEQYITGREIECAVLGNSPPEASQPGEIVISK
NYEFYTFDAKYVDPDAVRIDVPAKLPKAIAEKIRKASVKAYEALHCKDFSRIDLFLDKKG
NIYINEINTIPGFTNSSMYPMMWKERGVSFAELITRLLTLAQERYDRGKRIERDFQSSLK
F
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaaagaagaaagtagccatcctctatggcggccgctcagtggagcacgccgta
tcggtcaattcggcccgcaacatttttgagttcctcgacaaatccaaattcgaacccctg
cccatcggcatcagcaaaagcggccagtggtttctcaccgaaggcgttagcaaagacatt
cagaaaggacaaacgcttggactttcactgaatgccggcaagcccaccttcctgctggag
aaaagcggcgaaaagttttccgtcgacgtcctcttccctgtgctgcacggcaccgatggt
gaagatggcagcatccaggggttgatcaaagcgatggacctgcccatggtgggcaccggt
gtgctgggctcatccctatccatgaacaagatcgtggccaagcgtctcatgcgcgaagcc
ggtttgccggtgacggactttgtgacgttccgctatgacgaaaaagataagatcagtttc
accgccctctcgaaaaaactcggactgcccttcatggtgaaggccgccagcctcggctcg
tccgtgggtgtggccaaggtgaaatcgaaaaaggattttgccgcggctgtggaagaagcc
ttcaaatacgatgacgagatgttggccgaacaatacattacggggcgcgaaatagaatgc
gccgtgttgggcaacagcccgccggaagcttcgcagcccggtgaaattgtgatcagcaaa
aattacgaattctacaccttcgatgccaagtatgtggaccccgatgccgtgcgcatcgac
gtgcccgccaagttgcccaaggccattgccgaaaagatccggaaagcgtctgtgaaagcc
tacgaggccctgcattgcaaagacttttcacgcatcgatcttttcctggataagaaagga
aatatctacatcaacgagatcaacaccatccccggctttaccaattccagcatgtatccc
atgatgtggaaagagcgcggcgtgagctttgccgaactgatcacgcggctgctcaccctg
gcccaggagcgttacgaccggggcaaacgcatagagcgcgattttcaatcgtccctcaaa
ttctga

DBGET integrated database retrieval system