KEGG   Chloroflexus aurantiacus Y-400-fl: Chy400_0345Help
Entry
Chy400_0345       CDS       T00859                                 

Definition
(GenBank) restriction endonuclease R XbaI
Organism
chl  Chloroflexus aurantiacus Y-400-fl
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RE_ApaLI SPOR
Motif
Other DBs
NCBI-ProteinID: ACM51784
LinkDB All DBs
Position
409822..410442
Genome map
AA seq 206 aa AA seqDB search
MESVTDKIRSLASKYAQELQHKIETRTKELESDDQSHYLIYKVLGIQDDEGRLIDLYQNK
GRFLYKYAGAFLEEATFLCFKERFPHARRAQVENTSGQRPRQFHIDCLIDREAIEIKWRD
ATTDGDHIIKEHARIKVIKDHGFYPVRVMFFYPNREQAKRIQETIKTVYQGIGGACYTGD
DAWEYVRTRTGIDLKVILVNIAKDLQ
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtgttacagacaaaattcgttcattagcatcaaagtatgctcaagagctacaa
cacaagatcgaaactcgcaccaaagaattagaaagcgacgatcaatcacactatctgata
tataaagttctaggaatacaagatgatgaaggaagattaattgatctgtatcaaaacaaa
ggacgatttctttacaaatatgccggcgcatttctggaagaagctacctttctctgcttc
aaagaacgcttccctcatgcgagacgtgcgcaagtagagaacacatctggtcagcgtcca
cggcaatttcacatagattgcctgatagatagggaggcaatagagatcaaatggcgtgat
gctaccactgatggcgatcatattatcaaagaacatgcacggataaaggttattaaagat
cacggtttttatccagttagagttatgttcttctaccctaatcgagagcaggccaaaagg
atacaagagaccataaaaaccgtctatcagggtatcggaggagcatgttatactggagat
gatgcgtgggaatatgtaagaaccagaacaggcattgatttaaaggtgattctggtcaat
attgcaaaagatttgcaatga

DBGET integrated database retrieval system