KEGG   Chloroflexus aurantiacus Y-400-fl: Chy400_0944Help
Entry
Chy400_0944       CDS       T00859                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
chl  Chloroflexus aurantiacus Y-400-fl
Pathway
chl00010  Glycolysis / Gluconeogenesis
chl00030  Pentose phosphate pathway
chl00051  Fructose and mannose metabolism
chl00052  Galactose metabolism
chl00680  Methane metabolism
chl01100  Metabolic pathways
chl01110  Biosynthesis of secondary metabolites
chl01120  Microbial metabolism in diverse environments
chl01130  Biosynthesis of antibiotics
chl01200  Carbon metabolism
chl01230  Biosynthesis of amino acids
chl03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:chl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Chy400_0944
   00030 Pentose phosphate pathway
    Chy400_0944
   00051 Fructose and mannose metabolism
    Chy400_0944
   00052 Galactose metabolism
    Chy400_0944
  09102 Energy metabolism
   00680 Methane metabolism
    Chy400_0944
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    Chy400_0944
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:chl01009]
    Chy400_0944
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:chl03019]
    Chy400_0944
Enzymes [BR:chl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Chy400_0944
Protein phosphatases and associated proteins [BR:chl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Chy400_0944
Messenger RNA biogenesis [BR:chl03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Chy400_0944
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ACM52368
LinkDB All DBs
Position
1189555..1191798
Genome map
AA seq 747 aa AA seqDB search
MTHPTIRIGVLTSGGDAPGMNAAVRAVVRTGISRGCEVFAIYEGYQGLIEGGKLIRRMDW
SSVGGIIQRGGTIIGTARSAAFRTREGRRRAAANLLAHGIDRLVVIGGDGSLTGADLFRR
EWPELLAELVAAGEISSEQAAAHPNLLIAGIVGSIDNDFCGTDMTIGADTALHRITEAID
AISSTAASHQRTFVIEVMGRNCGYLALMGAIAGGADWAFIPEMPPQMDDWEQHMCDVLRI
GREQGRRDSIVVVAEGACDRDGKPITASYVKKILEERLGEDTRVTILGHVQRGGAPSAFD
RWMSSLLGATAVEELLEADPNAEPKLIGLRENRVVRLPLMTCVRDTHQVAEAIAQRDYER
ALAMRGNSFVEAYRTLGTLIQSQPSPPDRLRRGHRFAVLHSGGPAPGMNTAVRAAVRIGI
DRGHTMLGVRNGFQGLIDGDIHEMDWMSVSGWATMGGAELGTNRKVPQGSELYQIARNIE
RFGIDGILMIGGWTGYQAIYKLYSERHIFPAFNIPMICLPATIDNNLPGSELSLGADTAL
NSIVSAIDRIKQSAVASRRCFIVEVMGRDCGYLALMSGLATGAERVYLPEEGISLRKLQA
DLDEMMRWFRAGKRLSLIIRNEKANPIYTTSFICSLFEEEGGKLFEVRQAILGHLQQGGD
PSPFDRIQATRLAVRCIEFLVEHADRREPIGAFIGYRGGKVQIHQLDDMPRLMDPVHARP
REQWWMSLRQMTDLLTTPPSPTVESGK
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgacacatccaacgatccgaattggagtcttaaccagtggtggcgatgcgccgggtatg
aacgccgcagtacgggctgttgtacgcaccggcatcagtcgtggctgtgaagtctttgca
atctacgaaggctatcagggtctgatcgaaggtggaaaattgatccggcgcatggattgg
agttccgttggcggcatcatccagcgtggcggtacgatcattggtacggcgcgcagcgcg
gcattccgcacccgcgagggccgacgccgcgcagcagcgaatctcttggcccacgggatc
gaccgcctggtcgtgatcggtggtgatggcagcctcaccggtgccgacctctttcgtcgt
gaatggccggaactgctggccgaactggtcgcagctggtgagatcagcagcgagcaggcc
gccgcccatcccaatctcctcattgccgggattgtgggcagtatcgacaatgacttctgc
ggtaccgatatgaccattggtgccgacacggcgctgcatcgtatcaccgaggcgattgat
gcaatcagctcgacggcggccagtcatcagcgtacctttgtcatcgaggtgatggggcgg
aattgtggctacctggcgctgatgggggcgattgccggtggcgcagactgggcatttatc
cctgaaatgcctccccaaatggatgactgggagcagcatatgtgcgatgtgctgcggatc
ggacgcgaacaggggcgacgcgacagcattgtggtggtagccgaaggggcgtgtgatcgc
gacgggaaaccaatcacggcttcgtatgtcaagaaaattttggaagagcgtctgggtgaa
gataccagagtgaccatcctcggccacgtgcagcgtggtggcgctcccagcgcatttgat
cgctggatgagttcattattgggggcaacggcggttgaagagttactggaagccgatccc
aatgccgaaccgaaactgatcgggttgcgtgagaatcgggttgtgcgtctaccactgatg
acctgtgtccgcgatacccatcaggttgccgaggcgattgcccagcgcgactacgaacgt
gcgctggcgatgcggggcaatagctttgtggaggcgtaccgcaccctcggcaccctcatt
cagtcgcagccctcgccccccgaccgattacggcgcgggcatcgcttcgcagtgctgcac
agtggcggcccggcaccgggaatgaatacggcggtacgggcagcggtgcggatcggcatt
gaccgcggccatacgatgctcggtgtgcgcaatgggtttcagggactgatcgatggcgac
atccacgaaatggattggatgagcgtaagtggttgggcaacgatgggtggcgccgagctg
ggcaccaatcgcaaggtgccgcaaggcagcgagctataccagattgcccgtaacatcgag
cgcttcggaattgacggtatcttgatgatcggtggttggaccgggtatcaggcaatctac
aagctgtacagcgagcgacacatcttcccggcattcaacatccctatgatctgcttgccg
gcaacgattgacaacaatcttcccggttctgagctgagtctgggtgcagataccgcattg
aacagcatcgtcagtgcaattgatcggatcaagcagtcggcggtggcttcacggcgctgt
ttcattgtcgaagttatggggcgtgactgtggttatctggccttgatgagcggattggca
accggcgccgagcgggtctacctccccgaagaaggcatcagcctgcgcaaattgcaagcc
gatctcgacgagatgatgcgctggtttcgtgctggtaagcgcctgagtttgatcattcgc
aatgaaaaagcgaatccgatctacaccacctcgttcatctgctcgttgtttgaagaagag
ggtggtaagctattcgaggtacggcaggcgattctcggtcatttgcagcagggaggtgat
ccttcgccgttcgaccgtattcaggctacccgtctggccgtgcgctgtatcgagttcctg
gtcgagcacgctgaccgtcgcgaaccaatcggggcgttcatcggctatcggggcggtaaa
gtccagatacatcagctcgacgatatgccacgcctgatggatccggtgcatgcccgtccg
cgagagcagtggtggatgtctttgcggcaaatgaccgatttgctcacgacgccgccatca
cctaccgttgagagcgggaagtaa

DBGET integrated database retrieval system