KEGG   Chloroflexus aurantiacus Y-400-fl: Chy400_1475
Entry
Chy400_1475       CDS       T00859                                 

Definition
(GenBank) alpha/beta hydrolase fold protein
  KO
K10216  2-hydroxymuconate-semialdehyde hydrolase [EC:3.7.1.9]
Organism
chl  Chloroflexus aurantiacus Y-400-fl
Pathway
chl00362  Benzoate degradation
chl00622  Xylene degradation
chl00643  Styrene degradation
chl01100  Metabolic pathways
chl01120  Microbial metabolism in diverse environments
chl01220  Degradation of aromatic compounds
Module
chl_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:chl00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Chy400_1475
   00622 Xylene degradation
    Chy400_1475
   00643 Styrene degradation
    Chy400_1475
Enzymes [BR:chl01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.9  2-hydroxymuconate-6-semialdehyde hydrolase
     Chy400_1475
SSDB
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Esterase Abhydrolase_2 Peptidase_S9 Abhydrolase_4 PGAP1 Abhydrolase_3 FSH1 Say1_Mug180
Other DBs
NCBI-ProteinID: ACM52893
LinkDB
Position
1870664..1871503
AA seq 279 aa
MVEHIITGQFTTALHRQGSGDAPAILFIHGSGPGANGWSNWNLALPALGEQWYCLAPDLI
GFGDSQHPDPPPTDIRRWMRLWVDQMLALLDTLGLARVDLVGNSMGGAVALHLLLEAPER
FRRVVLMGAIGAPCRLTPELDRLWGFYDDPSAALLAQAIRWFVYDDAFVRDRLDEIVRVR
YTAAMRTDVWRSYTAMFPAPRQQHLDALIVPDAALRRMTHPVLLIHGRDDAIVPADTSYY
LLNRLPNAELHVIGRCSHWTQIEHSQRFHQLVRTFFAET
NT seq 840 nt   +upstreamnt  +downstreamnt
atggttgaacacatcatcaccggtcaattcacaaccgccctccatcgacaggggtctggc
gatgcaccggccatcctcttcattcacggctccggcccaggtgccaatggctggtcgaac
tggaacctggcgctaccggcactgggtgaacagtggtactgtctggcgcctgacctgatc
ggatttggcgatagtcagcaccccgatccaccaccgacagacattcggcgctggatgcgg
ttgtgggttgatcagatgctggctctgctcgatacgttgggattagccagggttgatctg
gttggcaattcgatgggtggggcagttgcgttgcacttgttactggaagcgccagaacga
tttcggcgggtggtactgatgggagcgattggcgcaccctgtcggctgacaccagaactt
gatcgcctgtgggggttttacgacgatccatcggcagccttgctggcccaggccattcgc
tggtttgtctacgatgatgcgtttgtgcgcgaccggcttgatgagattgtgcgggtacgc
tataccgcagcgatgcgtactgacgtttggcgctcgtatactgccatgtttccggctccc
cgtcagcaacacctcgatgcattgatcgtacccgatgccgcgttacgccggatgacccat
ccagtgctgctgatccacggacgcgatgatgccattgtcccggctgataccagctactat
ttgctcaaccggcttcccaatgctgaactccatgtgataggacgctgtagccactggacc
cagattgaacacagtcaacgctttcatcagcttgtgcgtacattttttgccgagacctga

DBGET integrated database retrieval system