KEGG   Chloroflexus aurantiacus Y-400-fl: Chy400_2351Help
Entry
Chy400_2351       CDS       T00859                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
chl  Chloroflexus aurantiacus Y-400-fl
Brite
KEGG Orthology (KO) [BR:chl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:chl03012]
    Chy400_2351
   03029 Mitochondrial biogenesis [BR:chl03029]
    Chy400_2351
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:chl04147]
    Chy400_2351
Translation factors [BR:chl03012]
 Eukaryotic Type
  Elongation factors
   Chy400_2351
 Prokaryotic Type
   Chy400_2351
Mitochondrial biogenesis [BR:chl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Chy400_2351
Exosome [BR:chl04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Chy400_2351
  Exosomal proteins of breast cancer cells
   Chy400_2351
  Exosomal proteins of colorectal cancer cells
   Chy400_2351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ACM53746
LinkDB All DBs
Position
2973554..2974759
Genome map
AA seq 401 aa AA seqDB search
MAKQKFERTKPHINVGTIGHVDHGKTTLTAAITKVLSLKGAAQFMAYDQIDNAPEERARG
ITIAIRHVEYQTDKRHYAHVDCPGHADYIKNMITGAAQMDGAILVVSAPDGPMPQTREHI
LLARQVQVPAIVVFLNKVDMMDDPELLELVELELRELLSKYGFPGDEIPIVRGSARNALE
SPSKDINAPEYKCILELMNAVDEYIPTPQRAVDQPFLMPIEDVFGIKGRGTVVTGRIERG
KVKVGDTVEIVGMTNDAPRRTVVTGVEMFQKTLDEGIAGDNVGCLLRGIERTDVERGQVL
CAPGSIKPHKKFEAQVYVLKKEEGGRHTPFFSGYRPQFYIRTTDVTGAIGLPAGMEMVMP
GDNVVMTIELIVPVAIEEGLRFAIREGGRTVGAGVVTKILD
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggccaaacagaaattcgagcggacaaaaccgcacatcaacgtcggcaccatcggtcac
gtagaccacggtaagacgaccctgaccgctgcgattaccaaggtgctgtcgctcaagggt
gcagctcagtttatggcgtatgaccagatcgacaacgcccccgaagagcgcgcccgtggc
attacgattgctattcgtcacgtcgagtatcagaccgacaagcgccactatgcgcacgtc
gactgccccggtcacgccgactacatcaagaatatgattaccggcgcggcccagatggac
ggcgccattctggtggtgagcgctcccgatggcccgatgccgcagacccgtgagcacatt
ctgctcgcccgccaggtgcaggtgccggccatcgtggtcttcctgaacaaggtcgatatg
atggacgacccggagctgctggagctggtcgagctggagctgcgcgagctgctcagcaag
tacggcttcccgggtgatgagattccgattgtgcgcggcagcgcccgcaacgcgctggaa
agcccgagcaaggacatcaacgccccagagtacaaatgtattctggagctgatgaatgcg
gtggacgagtacattccgacgccgcagcgggcagtggatcagccgttcctgatgccgatt
gaggacgtgttcgggatcaaggggcgcggtacggtggtgacgggccggatcgagcgcggg
aaggtgaaggtcggtgacacggttgagatcgtgggcatgaccaacgacgcgccgcggcga
acggtggtgaccggcgtggagatgttccagaagacgctggacgaagggattgctggtgac
aacgtcggctgtctgctgcgtggcattgagcgcaccgatgtggagcgcgggcaggtgttg
tgcgcaccgggcagcatcaagccgcacaagaagttcgaggcgcaggtctacgtgttgaag
aaggaagagggtggccgccacacgccattcttctcggggtaccgcccgcagttctacatt
cgcacgaccgacgtgacgggggcgattggcctgccggcggggatggagatggtgatgccg
ggcgataacgtggtgatgacgattgagctgatcgtcccggtggctatcgaagagggcttg
cgcttcgcaatccgcgaaggtggccgcaccgtcggtgctggtgttgtaaccaagatcctc
gattaa

DBGET integrated database retrieval system