KEGG   Chloroflexus aurantiacus Y-400-fl: Chy400_2868Help
Entry
Chy400_2868       CDS       T00859                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K08884  serine/threonine protein kinase, bacterial [EC:2.7.11.1]
Organism
chl  Chloroflexus aurantiacus Y-400-fl
Brite
KEGG Orthology (KO) [BR:chl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:chl01001]
    Chy400_2868
Enzymes [BR:chl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Chy400_2868
Protein kinases [BR:chl01001]
 Serine/threonine kinases: Other
  Bacterial family
   Chy400_2868
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH zf-ribbon_3 zinc_ribbon_2 DZR zf-RING_7 Prok-RING_1 zinc_ribbon_15 DNA_ligase_ZBD DUF35_N Fructosamin_kin Seadorna_VP7 UPF0547 Kinase-like zinc-ribbons_6
Motif
Other DBs
NCBI-ProteinID: ACM54256
LinkDB All DBs
Position
complement(3550519..3551814)
Genome map
AA seq 431 aa AA seqDB search
MRCPQCGASVHDQIIFCPECGARIRREEVPATTPPLQVLQGRYELRRRLGAGGMGSVYLA
TDRRLSTAQWAVKEMSDTAITSPLERQQAQAAFQQEAELLARLSHPSLPRVTDHFEENGR
HYLVMEFVPGENLRDYVNRVGLPRPLHEVLRWTAQICEVLAYLHTQQPPIIFRDLKPTNI
MITPEGTIKLVDFGIARLFKPDKERDTQAFGTPGYSAPEQYGRGQTDARSDIYSLGVLMH
HLLTGHDPSTTPFRLPPITQLNPSVPAYIAAAIARATDNDPSRRFASVIEFQQALFGSQQ
LVNVQPGVASVAARSGPIGSEVTAVTPSTGMAIAGRWIGIISDVLMVVAIILAAFTLFGA
DELFGGFGLILAMGAILFALIGGTLSLIALVSPNTAQTLHGRRDAAIGFASSSGAFLLCC
VLGFMIAQMGS
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgagatgtccacaatgtggcgctagtgtacacgatcagattatcttctgcccggaatgt
ggagcacggatccgcagagaggaagtaccggccacaaccccgccacttcaggtgttgcag
ggacgctatgagctgcgacggcgactcggcgcaggtggaatgggatcggtctatctggcc
acagatcgacgactcagtaccgcccaatgggcggttaaggagatgagcgacaccgctatc
acctcaccgcttgagcgccagcaggcccaggctgcattccagcaagaggcagaattactg
gcgagattgagccatccttccttaccgcgggtcaccgatcactttgaagagaatggtcgg
cactacctggttatggagtttgtgcccggcgagaacttgcgcgattatgttaatcgcgta
gggttgccgcgccccctgcacgaagtcttgcgctggactgcccagatttgtgaggtgctg
gcctacctgcatacccagcagccaccgatcatctttcgcgatctgaaaccgacgaacatc
atgatcacgccggaaggcacaatcaagctggttgatttcggcattgcccgacttttcaag
ccagacaaggagcgcgatacgcaggcattcggtacccctggctacagcgcccccgaacag
tacggtcgtgggcagaccgatgcccgctccgacatttacagcctcggcgtcttgatgcac
catctgctcaccggtcacgatcccagcaccacgccgtttcgcttaccgccgatcacgcaa
ctcaatccctcggtaccggcgtatatagcagcggcgattgcccgcgccacagataacgat
ccgagccgccgctttgccagtgtgatcgagttccagcaggcactgtttggcagccaacaa
ctggtcaatgtgcaaccaggcgttgcatcagtagctgctcgctccggccctattggcagt
gaggttactgccgttacacccagtaccggaatggccatcgccgggcgctggatcggaatc
attagtgatgtgttgatggtggttgcgatcatcctggcagcctttacccttttcggcgcc
gatgagttgttcggtggcttcgggttaattctcgctatgggagcaatcctgttcgcgctc
attggtggtactctcagcctgattgctctggtcagtccgaatacggctcaaacactacac
gggcggcgcgatgcggctattggctttgcgagtagtagcggcgcctttctactctgttgt
gtgttaggtttcatgattgcacagatgggatcataa

DBGET integrated database retrieval system