KEGG   Chloroflexus aurantiacus Y-400-fl: Chy400_3413Help
Entry
Chy400_3413       CDS       T00859                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
chl  Chloroflexus aurantiacus Y-400-fl
Pathway
chl00620  Pyruvate metabolism
chl00680  Methane metabolism
chl00720  Carbon fixation pathways in prokaryotes
chl01100  Metabolic pathways
chl01120  Microbial metabolism in diverse environments
chl01200  Carbon metabolism
Module
chl_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:chl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Chy400_3413
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Chy400_3413
   00680 Methane metabolism
    Chy400_3413
Enzymes [BR:chl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Chy400_3413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ACM54789
LinkDB All DBs
Position
complement(4251911..4254712)
Genome map
AA seq 933 aa AA seqDB search
MSGRTTANEHDLLSANIRALGDALGRVIIGQHGSEALALVEQVRRMAKDLRNAPTNTDPQ
ALPQLIADLDLPQLRSLVKAFTLYFGLVNLAEGVERLRVLRARDLRHAPAPRAESIADAI
ELLKRHGVPAPAIQEWLDHALIMPVLTAHPTESRRRTILIKLRRIFDTLVDLTFGERLVL
PADRQAALTRIEREIVGLWQSDDVRNRRPSVLDEVENGLFFFQTVLWELLPHIYREMSDA
LQAAYPDHPWRLPPFLRFGSWMGGDRDGNPFVTPEVTVETVRLMRSAMLRYLIDCLDRLI
TDLSQSVQQVKVDTAIIDRIAEYRELMPDAAATLNPHYRCEPYRQLCHFIQARLHNTLQY
TLDYTPRWGIDPPLARRPDIYYHSRELLADLDLIDASLRNNGSTLIAEGLLRDVRTLVAV
CHLHTATLDVRQHASRHTAALSEILAAAGVVDDYEALDEAERIAVLSVEIRRPRPLTPSR
LSHFSPATAETIHTFRVIAAISEQLDPEIFQTYIISTTSQVSDLLAVLLLCRDAGLYQPG
QASQLHIVPLFETGDDLQRAPALLDELLRLPVYREHLALRDNLQEVMLGYSDSNKEGGFV
AANWALYRAQVELTAVTDRHGVRLRLFHGRGGAVGRGGGPAGQAILAQPPGTLHGQIKVT
DQGEMISDRYLDPRTAHRHLEQVVNAVLRAGFPGMARQPEPTWLAAMEEMATTARTVYRQ
LVYEDPDFLIYFRSATPVAEFNRLRIGSRPVSRRKSDRIEDLRAIPWVFSWMQSRHTIPG
WFGLGSALEAFVEADPHHLHLLRTMYQHWPFFSTLLDNAQMIMLKADMNIARAYASLVPD
RHLAERIFQRIESEFRRTERMICQITERNDLLAHQPVLQRAIRQRNPYIDPLSFVQIELL
RRLRAAPPEEQGELETVLLMSINGIAAGLKNTG
NT seq 2802 nt NT seq  +upstreamnt  +downstreamnt
atgagcggacgaaccactgctaacgaacatgatctgttatcggcaaacattcgcgcacta
ggcgatgcacttggccgggtcattatcggtcaacacggtagcgaagcactggcactggtg
gaacaggtgcgccggatggctaaagacctccgcaatgcaccaaccaacaccgatccacag
gcacttccccaattgattgccgatctggatttgccacaattacgcagtctggtcaaggca
ttcacgctctattttggattggtcaatctggcggaaggggttgaacgtctgcgcgttttg
cgggcgcgcgatctacgccatgcgcccgccccccgtgccgagagtattgccgacgctatc
gaattgctgaagcgtcacggagtaccggcacctgcgatccaggaatggctggatcacgcg
ctgattatgccggtgttgacggcgcacccgaccgagtcgcgccggcgcacaatcctgatt
aaactgcggcgcatttttgatacgctggtcgatttgacatttggagagcggttggtctta
cctgccgaccggcaggccgcgcttacccgcatcgagcgggagatcgtcgggttgtggcag
agcgatgatgtgcgtaatcggcgaccatcggtgctcgacgaagtggagaatggactgttc
ttctttcaaaccgtcctctgggaactcctaccgcacatctatcgtgagatgagtgatgcg
ctgcaagcagcatatccggatcacccctggcgtctgccgccatttctgcgctttggaagc
tggatgggcggggatcgcgacggcaatcccttcgtgacgccagaggtaacggtcgagacg
gtacggctgatgcggagcgcaatgctgcgttatctgatagattgccttgatcggctgatc
accgatttgagccaatcggtgcagcaggtgaaggtggatacggcgatcattgatcgcatc
gccgaatatcgcgagttgatgccagatgcagcagcgacgctcaacccgcattaccgctgc
gagccataccgccagttgtgccattttattcaggcccggctgcacaacacccttcagtac
acgttggactacacgcctcgttgggggatcgatccaccgctcgcacggcgacccgacatc
tactaccatagccgcgaactcttagccgatctcgacctgatcgatgccagtctgcgcaat
aacggcagtacgttaatcgccgagggtctgttgcgcgatgtacgaacgctcgtggcagtt
tgccatctgcacacggccaccctcgacgtgcgccagcacgccagccggcacacagcagcc
ctgagcgaaatcctggccgctgctggtgtggtcgacgattacgaagcgctcgatgaggca
gagcggattgcggtgttgagcgtggaaattcgccgaccgcgcccactcacgcccagccga
ctcagtcatttcagtccggcgacggcggaaaccattcacacctttcgggtcatagcggca
atcagcgaacagctcgacccagaaatctttcagacgtacatcatctcgaccaccagtcag
gtcagcgatctgctggcagtgttgctgctctgccgcgatgccggtctctaccagcccggt
caggccagtcagttgcatattgtgccgctgtttgaaacgggtgacgacctgcaacgcgca
ccggcgctcctggatgaactgctccgcttgccggtgtaccgtgagcatctggcgctacgc
gacaacctgcaagaggtgatgctcggttattccgacagcaacaaagagggtggctttgtg
gctgcaaactgggcactctaccgggcacaggtggaactgacagcggtcacagatcggcac
ggcgtccgcttgcgcctcttccatggccgcggtggcgctgttggccgcggtggcggccct
gccggacaggccatcctcgcccaaccacccggaaccctccacggtcagatcaaggttact
gaccagggtgaaatgatctcagaccgttatctcgatccgcggactgcccatcgtcacctc
gaacaggtggttaatgccgtgttgcgggcgggctttcccggcatggcgcggcagcccgaa
ccaacctggctggccgcgatggaggagatggcgactacggcacgtactgtctaccggcaa
ctggtttacgaagacccggattttctgatctattttcgcagtgccacaccggtggccgaa
ttcaaccggctacgcatcggctcacgtccggtctcgcgccgcaagagtgatcggatcgaa
gacctgcgggccattccatgggtctttagctggatgcagagtcggcacacgattccgggc
tggtttggcctgggcagtgcgctggaagcatttgtggaagccgatccgcatcacctgcat
ctattgcgcaccatgtaccagcactggccctttttcagcacgctgctggataacgcgcag
atgatcatgctgaaagccgatatgaacattgcccgcgcttacgccagcctggtgccggat
cgtcatctggccgaacggatctttcagcggatcgagagcgaattccgccgcaccgaacgt
atgatctgtcagatcaccgaacgcaacgatctgttggcccatcaaccggtacttcagcgg
gcgattcggcagcgcaacccgtacatcgatccactcagctttgtccagattgaactgctc
cgccgattgcgcgctgcgccgcccgaagaacagggcgaattggaaacggttttgttgatg
tcaatcaacggcattgctgccggattgaagaatacaggctga

DBGET integrated database retrieval system