KEGG   Chlamydia sp. S15-834C: C834K_0042Help
Entry
C834K_0042        CDS       T05716                                 

Gene name
pknB
Definition
(GenBank) Serine/threonine-protein kinase pknB,serine/threonine-protein kinase,Predicted ATPase,TOMM system kinase/cyclase fusion protein,Protein kinase domain
Organism
chla  Chlamydia sp. S15-834C
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal APH Kdo Haspin_kinase Kinase-like SpoIIE Seadorna_VP7 Choline_kinase
Motif
Other DBs
NCBI-ProteinID: SYX08531
UniProt: A0A3B0PR71
LinkDB All DBs
Position
I:47870..49375
Genome map
AA seq 501 aa AA seqDB search
MDCQSEIPSQNQVIGEYHIKQILSKKEGSAVYRGLHPNTLQSVAIKVLATPLVADTSRVH
NFLKEARIVEQISHPNIVKLYQYGQCRKGLYIAMEYIQGVSLRHYILSQLIPLSRAIDIV
LHIAQALEYLHSRGILHRDIKPENILMTSQGQIKLIDFGLAACSMDEDTHLACLGTPSYM
SPEQRQGDKISESSEIYSLGLIAYELILGNLALGKVVLSLIPNRVSKILAKALQPSPKDR
YGSMKEFISDLHRYRHGEDLQKDKRNKDHTALVNDQLYHQRFWLSPLEIVAPEFLSVSIY
EQGYPTHPHVYYEAYMSEDGFRIWFCYSLSGNPTLVLTIMKSFVSQWGHEDNIRSAIRKI
HSELMRINVPIDEKGISLICVTISKEKKELSWIACGKTNFWLQKQGKVAQNFTTSSSGLG
KISSLQIQETKVAWEIGDGAVLHTLQADDSMSSLHSPLFTELKDRGQTAIFCPIESVRYG
ILGNHDGNLCPSTLISLKRIR
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggattgtcaatccgaaataccttctcaaaatcaggtgattggtgaatatcacatcaaa
caaatcctgagtaagaaagagggtagtgcggtataccgaggtttacatcctaatactcta
caatctgtagctattaaggttcttgcaacacccttggttgctgatacatcacgagttcat
aatttcttaaaagaagcgcggattgttgagcaaatctcacatccaaatattgttaagtta
taccaatacggacaatgtaggaaaggtctgtacatagctatggaatatattcagggagtt
tctcttagacactacattctctcccagctgattcctttatcacgtgctattgatattgtc
ttacatattgcccaagctcttgaatatctacatagccgaggcattctccatagggatata
aaaccagaaaatattcttatgacatctcaaggacaaatcaagcttatagattttggtctt
gctgcgtgttctatggatgaagatactcatcttgcgtgtttgggaacaccttcatacatg
agtcctgaacaacgtcaaggagataagatctctgaaagttcagaaatctattcattgggt
ttaatagcatacgaattaatcttaggaaatttagccttaggcaaagttgttttatctttg
attccaaatagagtgagcaagatcctagcaaaggctttacaaccctctcctaaagatcgt
tatggatctatgaaggaattcatctcagatttacatagatatcgtcatggtgaagatctt
caaaaagataagcgtaataaagatcataccgcactggtgaatgatcagctatatcatcag
agattttggttatctcctttggaaattgttgctcctgaatttttatcggtttctatatat
gaacaaggatatcctacgcatcctcatgtatactatgaagcttatatgagtgaggatggt
tttagaatatggttttgttatagtctttcaggaaatccaactttagtattaactattatg
aagagcttcgtaagtcaatggggtcatgaagataacattagaagtgcgattcgtaagatt
catagtgagctaatgcgtataaatgttcctatagatgaaaagggaatttccttaatttgc
gtaactatttcgaaagaaaaaaaggaactttcttggattgcttgtgggaaaactaatttc
tggttacaaaaacaaggaaaggttgctcagaattttactacttcgtcctcaggtctagga
aaaattagttctttacaaattcaggaaaccaaggttgcatgggaaataggtgatggagca
gtattacataccttacaggcagacgattccatgtcatctttacatagtcctttattcaca
gagttgaaagatagaggacaaacagctatattctgcccaatagagagcgtacggtacggg
atattaggaaatcatgacggaaatctttgtccctcaacacttatcagcttaaaaagaatc
cggtga

DBGET integrated database retrieval system