KEGG   Chlamydia sp. S15-834C: C834K_0366Help
Entry
C834K_0366        CDS       T05716                                 

Gene name
sodA
Definition
(GenBank) Superoxide dismutase [Mn/Fe],superoxide dismutase,Iron/manganese superoxide dismutases, alpha-hairpin domain
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
chla  Chlamydia sp. S15-834C
Brite
Enzymes [BR:chla01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     C834K_0366 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_N Sod_Fe_C Imm3 Ubie_methyltran
Motif
Other DBs
NCBI-ProteinID: SYX08829
UniProt: A0A3B0PM70
LinkDB All DBs
Position
I:396137..396754
Genome map
AA seq 205 aa AA seqDB search
MTFVPYTLPELPYDYDALEPVISAEIMRLHHQKHHQGYINNLNDALKKLDVAGAQQDLTR
LISLEPAIRFNGGGHINHSLFWEMLAPVDRDGGVPPKYGLLKLIEKFWGTFDNFLKEFIE
FAAPIQGSGWAWLAFCPQKQELMLHATVNQDPLEATTGKVPLLGVDVWEHAYYLQYKNVR
LDYLKAIPRVINWGYIENRFSELTN
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgacctttgtaccctatactttacctgaattaccctatgattatgatgctctagaacca
gtgattagtgcagaaattatgcgcttacatcatcaaaagcatcatcaaggttatataaat
aatttaaatgatgctttgaaaaaattagatgttgccggtgctcaacaagatctgacacgt
cttatttctttagagcctgccatacgttttaatggcggtgggcatatcaatcattcccta
ttttgggaaatgttggctccagtagatcgggatggaggtgtgcctccaaaatacggattg
ctcaagctaattgagaaattttggggaactttcgataatttcttaaaagaatttattgaa
tttgcagctcctattcaaggatctgggtgggcatggctagctttttgtccccaaaaacag
gaacttatgctacatgcaacagttaaccaagatcctctagaggcgaccactggtaaggta
ccccttctaggagtggatgtctgggagcatgcttactatctccagtataaaaatgttaga
ttagattatttaaaagcaattcctcgagtaattaactggggttatattgaaaacagattt
tctgaattaactaattaa

DBGET integrated database retrieval system