KEGG   Corynebacterium humireducens: B842_01715Help
Entry
B842_01715        CDS       T03576                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
chm  Corynebacterium humireducens
Brite
KEGG Orthology (KO) [BR:chm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:chm03012]
    B842_01715
   03029 Mitochondrial biogenesis [BR:chm03029]
    B842_01715
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:chm04147]
    B842_01715
Translation factors [BR:chm03012]
 Eukaryotic Type
  Elongation factors
   B842_01715
 Prokaryotic Type
   B842_01715
Mitochondrial biogenesis [BR:chm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    B842_01715
Exosome [BR:chm04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   B842_01715
  Exosomal proteins of breast cancer cells
   B842_01715
  Exosomal proteins of colorectal cancer cells
   B842_01715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AJE32198
UniProt: A0A0B5D799
LinkDB All DBs
Position
360137..361327
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTTTTAAITKVLADAYPDLNESFAYDAIDKAPEEKE
RGITINISHVEYQTEKRHYAHVDAPGHADYIKNMITGAAQMDGAILVVAATDGPMPQTRE
HVLLARQVGVPYILVALNKCDMVDDEEIIELVEMEVRELLAEQDYDEEAPIIHISALGAL
NGEQKWVDSVLELMQACDDSIPDPERETDKPFLMPVEDIFTITGRGTVVTGRVERGQLNV
NDEVEIIGIKEKSTTTTVTGIEMFRKLLDYTEAGDNCGLLLRGIKREDVERGQVIIKPGA
YTPHTEFEGSVYVLSKDEGGRHTPFFDNYRPQFYFRTTDVTGVVKLPEGVEMVMPGDNVD
MSVTLIQPVAMDEGLRFAIREGSRTVGAGRVTKIIK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaggcgaagttcgagcgtacgaagccccacgtcaacatcggcaccatcggtcac
gttgaccacggcaagaccaccaccaccgccgccatcaccaaggttctggccgacgcttac
ccggacctgaacgagtccttcgcctacgacgccatcgacaaggcgccggaggagaaggag
cgtggcatcacgatcaacatctcccacgtcgagtaccagaccgagaagcgtcactacgca
cacgttgacgccccgggtcacgccgactacatcaagaacatgatcaccggtgccgctcag
atggacggtgccatcctcgtggtcgccgccaccgacggcccgatgccgcagacccgcgag
cacgtgctgctggcccgccaggtcggcgtcccgtacatcctcgtcgccctgaacaagtgc
gacatggtcgacgatgaggagatcatcgagctcgtcgagatggaggtccgcgagctgctg
gctgagcaggactacgacgaagaggctccgatcatccacatctccgctctgggcgccctg
aacggcgagcagaagtgggtcgactccgtcctcgagctcatgcaggcctgcgatgactcc
atcccggacccggagcgcgagaccgacaagccgttcctgatgccggtcgaggacatcttc
accatcaccggtcgtggcaccgtcgtcaccggccgcgtcgagcgcggtcagctgaacgtc
aacgacgaggtcgagatcatcggcatcaaggagaagtccaccaccaccaccgtcaccggt
atcgagatgttccgtaagcttctcgactacaccgaggccggcgacaactgtggtctgctg
ctccgcggcatcaagcgtgaggacgtcgagcgcggccaggtcatcatcaagccgggcgcc
tacaccccgcacaccgagttcgagggttccgtctacgtcctgtccaaggacgagggcggc
cgccacaccccgttcttcgacaactaccgtccgcagttctacttccgcaccaccgacgtc
actggtgtcgtgaagctgccggagggtgtcgagatggtcatgccgggcgacaacgtcgac
atgtccgtcaccctgatccagccggtcgccatggacgagggcctgcgcttcgctatccgc
gagggctcccgcaccgtcggcgctggccgcgtcaccaagatcatcaagtaa

DBGET integrated database retrieval system