KEGG   Corynebacterium humireducens: B842_07570Help
Entry
B842_07570        CDS       T03576                                 

Definition
(GenBank) polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
chm  Corynebacterium humireducens
Pathway
chm00010  Glycolysis / Gluconeogenesis
chm00520  Amino sugar and nucleotide sugar metabolism
chm01100  Metabolic pathways
chm01110  Biosynthesis of secondary metabolites
chm01120  Microbial metabolism in diverse environments
chm01130  Biosynthesis of antibiotics
chm01200  Carbon metabolism
Module
chm_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:chm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B842_07570
   00520 Amino sugar and nucleotide sugar metabolism
    B842_07570
Enzymes [BR:chm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     B842_07570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AJE33363
UniProt: A0A0B5DB34
LinkDB All DBs
Position
1543962..1544726
Genome map
AA seq 254 aa AA seqDB search
MLGAMTNIGFGIDIGGSGIKGARVDLDNGDFVGDRIKIATPRPATPEAVAKTVAEIVRLA
EWDGPVGLTMPSVIKAQIARTAANIDESWIGTDVHELFARHLGDREITVLNDADAAGIAE
VAFGDPRARQGSALFLTFGTGIGSALLIDGHLFPNTELGHLMIGDFEAEERASSAAKDRD
ELSFRKWAKRVNRVLAEYERLLNPGAFIVGGGISREHEKWVPLLEVEAPVFPAQLRNRAG
IVGAAMAVAAHVTP
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgctgggcgccatgaccaacatcggcttcggcattgacatcggcggctccgggatcaag
ggggcccgcgtcgacctggacaacggtgacttcgtcggcgaccgcatcaagatcgcgacg
ccgcggcccgcgaccccggaggcggtggcgaagaccgtcgccgagatcgtgcgcctcgcg
gagtgggacggcccggtgggcctgacgatgcccagcgtcatcaaggcgcagatcgcccgc
accgcggcgaacatcgacgagtcgtggatcggcaccgacgtccacgagctcttcgcccgc
cacctcggcgaccgggagatcaccgtgctcaatgacgccgacgccgccggcatcgccgag
gtcgccttcggcgatccgcgggcccgccagggttccgcgctgttcctcaccttcggcacg
ggcatcggctcggcgctgctcatcgacggccacctgttccccaacaccgagctcggccac
ctcatgatcggtgacttcgaggcggaggagcgggcctcctcggcggcgaaggaccgggac
gagctgagcttccgcaagtgggccaagcgcgtcaaccgggtcctcgccgagtacgaacgc
ctgctcaacccgggtgcgttcatcgtcgggggcggcatctcccgcgagcacgagaagtgg
gttccgctgctggaggtggaggccccggtcttcccggcgcagctgcgcaaccgggccggg
atcgtgggtgccgccatggccgtcgcggcgcacgtgacgccctga

DBGET integrated database retrieval system