KEGG   Corynebacterium halotolerans: A605_08245Help
Entry
A605_08245        CDS       T02472                                 

Definition
(GenBank) polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
chn  Corynebacterium halotolerans
Pathway
chn00010  Glycolysis / Gluconeogenesis
chn00520  Amino sugar and nucleotide sugar metabolism
chn01100  Metabolic pathways
chn01110  Biosynthesis of secondary metabolites
chn01120  Microbial metabolism in diverse environments
chn01130  Biosynthesis of antibiotics
chn01200  Carbon metabolism
Module
chn_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:chn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A605_08245
   00520 Amino sugar and nucleotide sugar metabolism
    A605_08245
Enzymes [BR:chn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     A605_08245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AGF72651
UniProt: M1P7L8
LinkDB All DBs
Position
1792621..1793376
Genome map
AA seq 251 aa AA seqDB search
MTNIGFGIDIGGSGIKGARVNLDDGEFIGERAKIATPKPATPDAVAEVVAEILRQEEWDG
PVGIALPSVIREQVALSAANIDPSWIGTNVHELFHRHLGEDREISVLNDADAAGLAEVSF
GEPAAAQGAVIFLTFGTGIGSAFLTEGRLFPNSELGHLIVDGEEAEWLASSAAKDREELS
FKKWAKRVSKVLAEYERLFSPTAFVVGGGISRDHERWVPHLTIDTPVIPAELRNRAGIVG
AAMAVSTHLAP
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaccaatatcggcttcggcatcgacatcggcggctccggcatcaagggggcgcgcgtg
aacctcgacgacggggagttcatcggcgagcgcgccaagatcgcgacgccgaagccggcg
acccctgacgcggtcgcggaggtcgtcgcggagatcctccggcaggaggagtgggacggc
ccggtcggcatcgcactgccgtcggtcatcagggagcaggtggcgctgtccgcggcgaat
atcgacccctcctggatcggcaccaatgtccacgagctgttccaccggcacctgggcgag
gaccgggagatcagtgtcctcaacgacgcggacgcggccggcctggccgaggtctccttc
ggcgagcccgccgccgcccagggtgcggtcatcttcctcaccttcggcaccggcatcggc
tccgccttcctcaccgagggccggttgttcccgaactccgagctcggacacctcattgtc
gacggcgaggaggcggagtggctggcctcgtcggccgcgaaggaccgcgaggagctcagc
ttcaagaagtgggccaagcgggtttcgaaggtgctcgccgagtacgagcgactcttctcc
cccaccgccttcgtcgtgggcggcggcatctcccgtgaccacgagcgctgggtcccgcac
ctgaccatcgacaccccggtcatcccggccgagctgcgcaaccgcgccggcatcgtgggg
gccgcgatggccgtctccacgcatctggcaccctag

DBGET integrated database retrieval system