KEGG   Corynebacterium halotolerans: A605_13500Help
Entry
A605_13500        CDS       T02472                                 

Definition
(GenBank) Multiple antibiotic resistance protein marR
Organism
chn  Corynebacterium halotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR HTH_27 MarR_2 HTH_20 TrmB HTH_IclR HxlR Rrf2 HTH_5 Replic_Relax SMC_ScpB HTH_1 Fe_dep_repress DprA_WH HTH_29 PadR HTH_Crp_2
Motif
Other DBs
NCBI-ProteinID: AGF73696
UniProt: M1PAJ0
LinkDB All DBs
Position
3012978..3013439
Genome map
AA seq 153 aa AA seqDB search
MTTPRPEDIAARIRPALTKLYVMYFRIAEQSDLTGPQLSILSRLKERGPSRISQIAREEG
IRMPTASNALHQLEQRELVERIRDESDRRGVRVTLTPLGESELQRVGEERTKYLADMIAT
LDEEQLSRVDELAGVINELADKYGADLISSDTE
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgacaactccgaggcccgaggacatcgccgcacgtatccgtccggcactcaccaagctc
tacgtgatgtacttccgcatcgcggagcagtccgacctgaccgggccgcagctgtccatc
ctgtcccgtctcaaggagcgtggcccctcacgcatcagccagatcgcccgggaggagggc
atccggatgcccaccgcctcgaacgcgctgcaccagctggagcagcgggagctggtcgag
cggatccgggacgagtcggatcgtcgcggtgtccgcgtcaccctcaccccgctgggggag
agcgagctgcagcgcgtcggcgaggagcgcacgaagtatctcgccgacatgatcgccacc
ctcgatgaggagcagctctcccgcgtcgacgagctcgccggcgtgatcaacgagctcgcc
gacaagtacggtgccgacctgatttcctccgacaccgagtaa

DBGET integrated database retrieval system