KEGG   Chondrocystis sp. NIES-4102: NIES4102_07110
Entry
NIES4102_07110    CDS       T05085                                 

Definition
(GenBank) dihydrolipoamide S-acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
chon  Chondrocystis sp. NIES-4102
Pathway
chon00010  Glycolysis / Gluconeogenesis
chon00020  Citrate cycle (TCA cycle)
chon00620  Pyruvate metabolism
chon01100  Metabolic pathways
chon01110  Biosynthesis of secondary metabolites
chon01120  Microbial metabolism in diverse environments
chon01200  Carbon metabolism
Module
chon_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:chon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIES4102_07110
   00020 Citrate cycle (TCA cycle)
    NIES4102_07110
   00620 Pyruvate metabolism
    NIES4102_07110
Enzymes [BR:chon01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     NIES4102_07110
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding DEC-1_N AATase DUF2868
Other DBs
NCBI-ProteinID: BAZ43710
UniProt: A0A1Z4RML2
LinkDB
Position
complement(794884..796182)
AA seq 432 aa
MIHDIFMPALSSTMTEGKIVEWTKSPGDKITKGETVLVVESDKADMDVESFNEGYLAVIL
VEAGQEAPVGSAIALIAETEAEIAEAKKQAASLKSDNGASTTAAKPETVKANAQVDVTST
TANNTASSNGSRAEGRIVASPRAKKLAKQLNIDLKTLEGSGPYGRITTGDVEKASGKTST
PTPATAVAPAPAPAPAPAPAPVPVVSSTPGETVPLNTLQKAVVQNMMASLQVPTFHVSYT
ITTDALDALYQQIKSKGVTMTALLAKAIAVTLKQHPVVNAGYRQDAISYNSEINIAVAVA
MPDGGLITPVLRNADQMDIYSLSRTWKDLVDRSRAKQLKPEEYSTGTFTLSNLGMFGVDS
FDAILPPGQGSILAVGGSKPQLVADNSGMMGVKRQMKVNITSDHRIIYGAQAAAFLKDLA
TLIETNPQSLTL
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgattcacgatatatttatgcccgccctcagttctactatgaccgaaggtaaaatagtc
gaatggacaaaatcgcctggggacaaaattaccaaaggagaaacggttttagtggtagag
tcggataaagccgatatggatgtagaatcttttaatgaaggttatctagctgtaatttta
gtagaagcaggacaagaagcacctgtaggtagtgcgatcgctcttattgcagaaaccgaa
gcggaaattgctgaagctaaaaagcaagcagcctcccttaagtctgataatggtgctagc
actacagcagctaaaccagaaacagttaaggcaaatgctcaggtagatgttacttctact
actgctaataatactgcttctagcaatggtagtcgtgcagaaggtagaattgttgcctct
ccaagagccaaaaaactagctaaacaattaaatatagatttaaaaacacttgagggtagt
gggccttatgggcgaattaccacaggtgatgtggaaaaagcttcgggtaaaacctccact
cccacacctgcaactgctgtagcaccagcaccagcaccagcaccagcaccagcaccagca
ccagtacctgttgttagttctacccctggagaaactgtacccctcaatacattacaaaaa
gcggtagtacagaacatgatggcaagtttgcaagtgcctactttccacgtttcctatact
attactaccgatgctttagatgcactttatcaacagataaaatctaagggtgtaactatg
actgccctattagctaaagcgatcgcggttactttaaaacaacatcctgtggttaatgct
gggtatcgtcaagatgctattagttataattccgaaataaatattgctgtggcggtggca
atgcctgatggcggtttgattacccctgtgctacgtaatgccgatcaaatggatatttat
tctctttctcgtacttggaaagacttagttgatcgctccagagctaaacaattaaaacca
gaggaatatagcactggtacatttaccctttctaacttagggatgtttggggtagatagt
ttcgatgctattttacctccagggcaaggttcaatcttagctgtaggtggttctaagcct
caattagtggctgataactcagggatgatgggtgtaaaacgtcagatgaaggttaatatc
acatccgaccaccgtattatctatggcgcgcaagcagcagcctttttgaaagatttggca
actttgattgaaacaaatcctcagtctttgacgctataa

DBGET integrated database retrieval system