KEGG   Chondrocystis sp. NIES-4102: NIES4102_07110Help
Entry
NIES4102_07110    CDS       T05085                                 

Definition
(GenBank) dihydrolipoamide S-acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
chon  Chondrocystis sp. NIES-4102
Pathway
chon00010  Glycolysis / Gluconeogenesis
chon00020  Citrate cycle (TCA cycle)
chon00620  Pyruvate metabolism
chon01100  Metabolic pathways
chon01110  Biosynthesis of secondary metabolites
chon01120  Microbial metabolism in diverse environments
chon01130  Biosynthesis of antibiotics
chon01200  Carbon metabolism
Module
chon_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:chon00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIES4102_07110
   00020 Citrate cycle (TCA cycle)
    NIES4102_07110
   00620 Pyruvate metabolism
    NIES4102_07110
Enzymes [BR:chon01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     NIES4102_07110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase DEC-1_N DUF2868
Motif
Other DBs
NCBI-ProteinID: BAZ43710
UniProt: A0A1Z4RML2
LinkDB All DBs
Position
complement(794884..796182)
Genome map
AA seq 432 aa AA seqDB search
MIHDIFMPALSSTMTEGKIVEWTKSPGDKITKGETVLVVESDKADMDVESFNEGYLAVIL
VEAGQEAPVGSAIALIAETEAEIAEAKKQAASLKSDNGASTTAAKPETVKANAQVDVTST
TANNTASSNGSRAEGRIVASPRAKKLAKQLNIDLKTLEGSGPYGRITTGDVEKASGKTST
PTPATAVAPAPAPAPAPAPAPVPVVSSTPGETVPLNTLQKAVVQNMMASLQVPTFHVSYT
ITTDALDALYQQIKSKGVTMTALLAKAIAVTLKQHPVVNAGYRQDAISYNSEINIAVAVA
MPDGGLITPVLRNADQMDIYSLSRTWKDLVDRSRAKQLKPEEYSTGTFTLSNLGMFGVDS
FDAILPPGQGSILAVGGSKPQLVADNSGMMGVKRQMKVNITSDHRIIYGAQAAAFLKDLA
TLIETNPQSLTL
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgattcacgatatatttatgcccgccctcagttctactatgaccgaaggtaaaatagtc
gaatggacaaaatcgcctggggacaaaattaccaaaggagaaacggttttagtggtagag
tcggataaagccgatatggatgtagaatcttttaatgaaggttatctagctgtaatttta
gtagaagcaggacaagaagcacctgtaggtagtgcgatcgctcttattgcagaaaccgaa
gcggaaattgctgaagctaaaaagcaagcagcctcccttaagtctgataatggtgctagc
actacagcagctaaaccagaaacagttaaggcaaatgctcaggtagatgttacttctact
actgctaataatactgcttctagcaatggtagtcgtgcagaaggtagaattgttgcctct
ccaagagccaaaaaactagctaaacaattaaatatagatttaaaaacacttgagggtagt
gggccttatgggcgaattaccacaggtgatgtggaaaaagcttcgggtaaaacctccact
cccacacctgcaactgctgtagcaccagcaccagcaccagcaccagcaccagcaccagca
ccagtacctgttgttagttctacccctggagaaactgtacccctcaatacattacaaaaa
gcggtagtacagaacatgatggcaagtttgcaagtgcctactttccacgtttcctatact
attactaccgatgctttagatgcactttatcaacagataaaatctaagggtgtaactatg
actgccctattagctaaagcgatcgcggttactttaaaacaacatcctgtggttaatgct
gggtatcgtcaagatgctattagttataattccgaaataaatattgctgtggcggtggca
atgcctgatggcggtttgattacccctgtgctacgtaatgccgatcaaatggatatttat
tctctttctcgtacttggaaagacttagttgatcgctccagagctaaacaattaaaacca
gaggaatatagcactggtacatttaccctttctaacttagggatgtttggggtagatagt
ttcgatgctattttacctccagggcaaggttcaatcttagctgtaggtggttctaagcct
caattagtggctgataactcagggatgatgggtgtaaaacgtcagatgaaggttaatatc
acatccgaccaccgtattatctatggcgcgcaagcagcagcctttttgaaagatttggca
actttgattgaaacaaatcctcagtctttgacgctataa

DBGET integrated database retrieval system