KEGG   Chondrocystis sp. NIES-4102: NIES4102_17900Help
Entry
NIES4102_17900    CDS       T05085                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
chon  Chondrocystis sp. NIES-4102
Pathway
chon00970  Aminoacyl-tRNA biosynthesis
chon01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:chon00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    NIES4102_17900
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:chon03029]
    NIES4102_17900
Enzymes [BR:chon01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     NIES4102_17900
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     NIES4102_17900
Mitochondrial biogenesis [BR:chon03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    NIES4102_17900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: BAZ44773
UniProt: A0A1Z4RQP0
LinkDB All DBs
Position
complement(2038369..2039823)
Genome map
AA seq 484 aa AA seqDB search
MYQGSIKALHQQLVKGECSAVEITQATLKQIAQVEPKVKAFISVTADQALATAKKVDAKI
AAGETIGILEGIPIGIKDNLCTKGIKTTCASQILADFVPPYESTVTQKLIDAGAVIVGKT
NLDEFAMGGSTENSSFQMTANPWDLERVPGGSSGGSAAAVAAGECVVSLGSDTGGSIRQP
ASLCGVVGMKPTYGLVSRYGLVAFGSSLDQVGPFARNVEDAAILLKEIAGHDPNDATSLK
VDIPDYRQYLQPKLKAGLKIGIIKETFGDGLDPIVAEKIQAAIATLEELGAEVKEISCPR
FRYGIAAYYIIAPSEASANLARYDAVRYGLRQNSDNLLEMYNNTRASGFGTEVKRRIMIG
TYTLSAGYYDAYYLKAQKVRTLIKQDFERAFEEVDVLVSPTAPTTAFKAGDKTTDPLSMY
LLDLMTIPVNLAGLPGMSIPCGFDNQGLPIGLQLISNVLREDLLFHTAYAYEQATQWHQQ
QPSL
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgtaccaaggaagtataaaagcgttacatcagcagttagttaagggcgaatgttcagcc
gtagaaattactcaggctactctcaaacaaattgcccaagtagaaccaaaagtaaaagcc
tttatctccgtaactgcggatcaagctttagccaccgccaagaaagtagatgcaaaaata
gctgctggggaaactattggaattttagaaggaattcccataggaataaaagataacctc
tgtaccaaaggcatcaaaactacttgcgcttcacagattttagctgattttgtacctcct
tatgaatcgacagttacccaaaaactcatcgatgcaggtgctgtaatagtgggtaaaacc
aacttagacgagtttgcaatgggaggttcgacagaaaactctagtttccaaatgacggct
aacccttgggacttagaaagagtacctggaggttcttctgggggttcggctgctgctgtt
gctgctggagaatgtgtggtttctttaggttcagatacaggcggatcaatccgtcaacct
gcttccctttgtggtgtggttgggatgaagcctacctatggtttagtttctcgctatggt
ttagtagcttttggttcatctttagatcaggttggcccatttgctcgtaatgtggaagat
gctgccattttacttaaagaaattgcaggacatgatcctaatgatgcaactagtttgaag
gtagatatccccgactacagacaatatttacaaccaaaactaaaggctggtttaaaaatt
ggcattattaaagaaacctttggggatggattagatccgatagtagccgaaaaaatccaa
gctgcgatcgcaactttagaagaattgggggcagaagttaaagagatttcctgtccacgt
tttcgttatggaatagctgcttattatattattgctccttctgaagcctccgccaattta
gcccgctatgacgcagttagatatggtttgcgccaaaactccgataacctattggaaatg
tataacaataccagggcttctgggtttgggacggaagttaaacgacgaattatgattggt
acttatactttgtcggcaggatattatgatgcgtattatcttaaagctcaaaaggtacgc
actttaattaaacaggattttgaacgtgcgtttgaagaggtggatgttttagtttctccc
actgcaccaactacagcttttaaagcaggggataaaaccacagatccattgagtatgtat
cttttagatttaatgactattcctgtaaatttagcaggtttaccaggtatgagtattcct
tgtgggtttgataatcagggtttacccattggtttgcaattaattagtaatgttttacgc
gaagatttactatttcatactgcttatgcttatgaacaagcaacacaatggcatcaacaa
caacccagtctttag

DBGET integrated database retrieval system