KEGG   Chondrocystis sp. NIES-4102: NIES4102_34900Help
Entry
NIES4102_34900    CDS       T05085                                 

Definition
(GenBank) ribonuclease BN
  KO
K07058  membrane protein
Organism
chon  Chondrocystis sp. NIES-4102
Brite
KEGG Orthology (KO) [BR:chon00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    NIES4102_34900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB
Motif
Other DBs
NCBI-ProteinID: BAZ46458
UniProt: A0A1Z4RVH4
LinkDB All DBs
Position
complement(3972349..3973257)
Genome map
AA seq 302 aa AA seqDB search
MRLQIKSIFKLLKEAFKEWQDDRASLLAAALAYYTVFSITPLLVIAIAIAGAVFGEEAAQ
GEIVEQINQLVGNEGAKAIETAIANADRPQLGSVASLISIAILLVGASGVFAQLQEALNT
VWNVQAKPHGGIWEFIRKRLLSFGMVLAIGFLLLVSLIFSAILSGISKLEVQVLTGFDYF
WNILNSIVSFGLITFLFALIYKYLPDVKIRWKDVLVGAIITTLLFSIGKSLIGLYLGRGS
FGSTYGAAGSLIVFLAWVFYSAQILLFGAELTQVYTYKYGAKIRPNKFAESTRDEKTKTK
FK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgcgactacaaattaaatcaattttcaagcttttaaaagaagcctttaaagagtggcaa
gatgatcgagcttccttattagctgctgccttagcatactatacagtattttctataact
cctttactagtaattgcgatcgcgatcgctggtgcggtttttggcgaggaggctgcacag
ggggaaatagtcgaacaaatcaatcaattggtaggtaatgaaggagcaaaggcaattgaa
acggctatagctaatgcagaccgaccacaattaggtagtgttgcatccctgattagtata
gcaattttactcgtgggtgcatcaggagtatttgcacaattacaagaagcacttaataca
gtctggaatgtacaagccaaaccacatgggggtatttgggaattcattcgcaaacgttta
ctgtcttttgggatggtgctagcgatcgggtttttgttgcttgtatctttaatttttagt
gcaattttatctggaattagtaaattagaagttcaagtacttacaggctttgattacttt
tggaatattcttaattccattgtttcctttggtttaattacctttttgtttgccctaatc
tataaatatttacctgatgtaaaaattcgctggaaagatgtgttggttggggcgattatt
acaacactattatttagtataggcaaatccttgattggtttatatttaggtagaggtagc
tttggatctacctatggtgctgctgggtctttaattgtttttctagcctgggtattttat
tctgctcaaattctactttttggcgcagaactaactcaagtttacacatataaatacggt
gctaaaattcgtccgaataaatttgccgagtctacgcgagacgaaaagactaaaactaaa
tttaagtaa

DBGET integrated database retrieval system