KEGG   Chondrocystis sp. NIES-4102: NIES4102_36380
Entry
NIES4102_36380    CDS       T05085                                 

Gene name
sodB
Definition
(GenBank) Mn-superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
chon  Chondrocystis sp. NIES-4102
Brite
Enzymes [BR:chon01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     NIES4102_36380 (sodB)
SSDB
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Other DBs
NCBI-ProteinID: BAZ46602
UniProt: A0A1Z4RVW8
LinkDB
Position
4134391..4134990
AA seq 199 aa
MAYELPSLPYDYKALEPLISQSTLEFHHDKHHATYVSKYNDAVKGTDLDDKSLEEVIKMT
AGDQSKSGLFNNAAQAWNHSFYWQCMKPGGGGTPTGELAEKIEADFGSFEKFVEEFKNAG
ATQFGSGWAWLVLDNGTLKVTKTLNAENPLTSGQVPLLTMDVWEHAYYLDYQNKRPAYID
DFLGSLVNWDFVAENLAAA
NT seq 600 nt   +upstreamnt  +downstreamnt
atggcttacgaattaccatctcttccatacgattacaaggcgttagaacccttaatttct
caaagcactttggaatttcatcacgacaaacatcatgctacttatgttagtaaatataat
gatgctgtcaaaggtacagatttagatgataaatccctcgaagaagtcattaaaatgact
gcgggagatcaaagtaaaagtggactattcaataatgctgctcaagcatggaatcattct
ttttattggcaatgtatgaaacctggtggtggtggtactcctacaggtgaattggctgag
aaaattgaggctgattttggtagctttgagaaatttgttgaagagtttaaaaatgcaggt
gcaactcaatttggtagtggctgggcttggttagtattggataatggtactctcaaagtt
actaaaactctaaatgcggaaaaccctttaactagtggacaagttccattgctaacgatg
gatgtttgggaacacgcttattatctagattatcagaataaacgtcctgcttacattgac
gattttcttggtagtttagttaactgggattttgtggctgaaaatttggctgctgcttaa

DBGET integrated database retrieval system