KEGG   Caulobacter henricii: AQ619_00620Help
Entry
AQ619_00620       CDS       T04110                                 

Definition
(GenBank) succinate dehydrogenase
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
chq  Caulobacter henricii
Pathway
chq00020  Citrate cycle (TCA cycle)
chq00190  Oxidative phosphorylation
chq00650  Butanoate metabolism
chq01100  Metabolic pathways
chq01110  Biosynthesis of secondary metabolites
chq01120  Microbial metabolism in diverse environments
chq01130  Biosynthesis of antibiotics
chq01200  Carbon metabolism
Module
chq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
chq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
chq_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:chq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AQ619_00620
   00650 Butanoate metabolism
    AQ619_00620
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AQ619_00620
Enzymes [BR:chq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AQ619_00620
    1.3.5.4  fumarate reductase (quinol)
     AQ619_00620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer2
Motif
Other DBs
NCBI-ProteinID: ALL11992
UniProt: A0A0P0NW04
LinkDB All DBs
Position
136857..137639
Genome map
AA seq 260 aa AA seqDB search
MVELALPKNSQVKAGKHWPAPAGATKVKTFKIYRYDPEAGGNPRWDTYDVDMDAVGPMVL
DALLFIKNTIDPTLAFRRSCREGVCGSCSMNIGGRNTLACTSGWADVPGKAVQIAPLPHA
PVVKDLIPDLTLFYAQYASVEPWLHTDTPEPQAEWRQSPEDRLKLDGLYECILCACCSTS
CPSYWWNGDKYLGPASLLHAYRWLIDSRDEATGDRLDALEDPFKLYRCHTIMNCAQVCPK
GLNPAKAIAEIKKMMVERVV
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggtcgagctcgcgcttcccaagaactcccaggtcaaggccggcaagcactggccggcc
cccgccggagccacgaaggtcaagaccttcaagatctatcgttacgatcccgaggcgggc
ggcaatccgcgttgggatacctatgatgtcgatatggatgcggtggggccgatggtcctg
gacgccctgctcttcatcaagaacaccatcgatccgaccctcgccttccgtcgatcgtgc
cgggaaggggtctgcggctcctgttcgatgaacattggcggccgcaacaccctggcctgt
accagcggctgggcggacgtgccgggcaaggccgtgcagatcgcgcccctgccgcatgcg
ccggtggtcaaggacctgatcccggacctgaccctgttctacgcccagtacgcctcggtc
gagccctggcttcacactgatacccccgagcctcaggccgaatggcgccagagcccggaa
gaccgtctgaagctggacggtctctatgagtgcatcctttgtgcctgctgctcgacctcg
tgccccagctactggtggaacggcgacaagtatctgggcccggcgtccctgctgcatgcc
tatcgctggctgatcgacagccgcgacgaggcaaccggcgaccgtctcgatgcgctggaa
gatccgttcaagctctatcgctgccacaccatcatgaactgcgcccaggtctgccccaag
ggcctgaatcccgccaaggcgatcgccgaaatcaagaagatgatggtcgagcgcgtcgtc
tga

DBGET integrated database retrieval system