KEGG   Caulobacter henricii: AQ619_06040Help
Entry
AQ619_06040       CDS       T04110                                 

Definition
(GenBank) glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
chq  Caulobacter henricii
Pathway
chq00500  Starch and sucrose metabolism
chq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:chq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AQ619_06040
Enzymes [BR:chq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     AQ619_06040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: ALL12947
UniProt: A0A0P0NXX1
LinkDB All DBs
Position
1290030..1292408
Genome map
AA seq 792 aa AA seqDB search
MRSVKILALATTAVSMLAGAAAAQSGPGAPGAPSTWAYAAKTGVGASYEAYVNGAYKDGG
PTGTVSKVWFSIADGVLTETMYGLIHQAQIKQLRFAVQTSTGLAIEGPDTVAKTEYLHVD
SAGRPLSPAYKITTTDRQGRFVIEKRIFTDGDRQSLFMRVTVRALKGSVTPYLLLEPHIA
NTGASDAGAATKAALTANEGSTFLTLKGSKPFAAASAGFIGSSDGLTDLKADGKLDKLYA
DTGAARGAILLTGQLPATDKAITVDYAIGFGPTAAASAASAEGSLKTGYDKVLARYNGQG
SAVGWEDYLASLTELPRLREAAMDGGTLVQASALMLKVQEDRTYAGALIASLSNPWGDTV
DASKPSTGYKAVWPRDFYQCAMALAALGDIQTPLAAFHYLPTVQVGPKTKGNTGAGGWFA
QKSEVDGTPEWVGVQLDQTAMPIMLGWKLWKQGWLPEAELKAYYASMIKPAADFLVDGGK
VGLGWNTATIIPPFTQQERWEEQAGHSPSTTAAVIAGLVVAGDIAEASGDAASAVRYRAT
ADAYSAKVESLMVTRKGSLGDGHYFLRLNSDQDPDNKSPVEVRNGQEAVAEDKMLDAGFL
ELVRYGVRQADDPAVLASLPELDDEALQDLYRVRYSFSFPGVEGTFPGWRRYGVDGYGED
TATGANYGAGDQMRPGQRGRVWPIFTGERGHYEIARITLRGKPAPGALEPVRQTYVKAME
LFANDGLLIPEQVWDGVGTAPARGYVRGEGTDSATPLAWSHAEYIKLLRSVADGVVWDSY
QPVKARFALPRP
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
atgcgttccgtaaagattctcgccctcgccacgaccgcggtttcgatgctggcgggtgcc
gcagcggcgcagtcgggccccggcgcgccgggcgcgccctcgacctgggcctatgcggcc
aagaccggggtcggtgcctcctacgaggcctatgtcaacggggcctacaaggacggcggc
cctacgggaacggtgtccaaggtctggttctcgatcgccgacggcgtcctgaccgagacc
atgtacggcctgatccatcaggcccagatcaagcagctgcggtttgccgtccagacctcg
acgggcctcgccatcgagggaccggacacggtcgccaagaccgaatacctgcatgtggac
tccgccggccgtccgctgtcgccggcctacaagatcaccaccactgaccggcagggccgc
tttgtcatcgagaagcggatcttcactgacggcgaccgccagagcctgttcatgcgggtc
acggtgcgggccctgaaggggtcggtcacgccctatctgctgcttgaaccccatattgcc
aataccggggccagtgacgccggtgcggcaaccaaggcggccctgaccgccaatgaaggt
tcgaccttcctgacccttaagggctccaagcccttcgccgccgccagtgcgggcttcatc
gggtcctcggatggtctgaccgacctgaaggccgacggaaagctggacaaactctacgcc
gacaccggagccgcacgcggggcgatccttctgaccggccagctacccgccaccgacaag
gcgatcacggtcgactatgcgatcggctttggaccgacggccgccgccagcgccgcctcg
gcggagggctcgctgaagaccggctatgacaaggtcctggcccgttacaatggccagggc
tctgcggtcggctgggaggactatctggcctcgctgaccgaactgccgcgcctgcgcgaa
gcggcgatggacggcggcacgctggtccaggccagcgccctgatgctgaaggtgcaggag
gaccgcacctatgccggggccctgatcgcctcgctgtccaacccctggggggacacggtc
gacgccagcaagccctcgaccggctacaaggccgtctggccacgcgacttctaccagtgc
gccatggccctggcagcgctgggcgatatccagacgcccctggcggctttccactacctg
cccacggtccaggtcggtcccaagaccaagggcaatactggtgcgggtggctggttcgca
cagaagtctgaagtggatggcacacccgaatgggtcggggtccaactggaccagaccgcc
atgccgatcatgctgggctggaaactgtggaagcagggctggctgcccgaggctgagctg
aaggcctattatgccagcatgatcaagccggcggcagacttcctggtcgatggcggcaag
gtcggcctcggctggaacaccgcgaccattatccctcccttcacccagcaggagcgctgg
gaggaacaggccggccattctccctcgaccacggcagccgtgatcgctggcctggttgtg
gcgggcgacatcgccgaagcctccggtgacgcagcctcggccgtgcgctaccgcgccacg
gccgacgcctattcggccaaggtcgagagtctgatggtcacgcgcaagggctcgctcggc
gacggccactatttcctgcggctcaacagcgatcaggatccggacaacaagagcccggtc
gaggtgcgcaatggccaggaggccgtggcggaggacaagatgctggacgccggcttcctg
gagctggtgcggtatggcgtccggcaggcggacgatccggccgtgctggccagcctgccc
gaactggatgacgaggccctgcaggacctctaccgggtgcgctacagcttcagctttccc
ggcgtggaaggcactttcccgggctggcggcgctatggcgtcgacggctatggcgaagac
acggccacgggggccaattacggggccggcgaccaaatgcgcccggggcagcgtggccgg
gtctggccgatcttcaccggcgagcgcggccactacgagatcgcccgcataaccttgcgc
ggaaagcccgcgccgggggccctcgagcccgtgcgccagacctatgtgaaagcgatggag
ctattcgccaatgacggcctattgatccccgaacaggtttgggacggcgtcgggaccgcg
ccggcccgtggctatgtgcgcggtgaggggacggactcggccacacccctggcctggtcg
catgccgaatacatcaagctcctgcgctcggtcgccgacggtgtggtttgggacagctac
cagcccgtaaaggcgcgctttgccctacccaggccctga

DBGET integrated database retrieval system