KEGG   Caulobacter henricii: AQ619_07690Help
Entry
AQ619_07690       CDS       T04110                                 

Definition
(GenBank) acyl-CoA synthetase
  KO
K00666  fatty-acyl-CoA synthase [EC:6.2.1.-]
Organism
chq  Caulobacter henricii
Brite
KEGG Orthology (KO) [BR:chq00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:chq01004]
    AQ619_07690
Enzymes [BR:chq01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     AQ619_07690
Lipid biosynthesis proteins [BR:chq01004]
 Acyl-CoA synthetase
  Unknown
   AQ619_07690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ALL15251
UniProt: A0A0P0P3Q0
LinkDB All DBs
Position
complement(1661076..1662779)
Genome map
AA seq 567 aa AA seqDB search
MITPTGTSRTVRFADFPTLTAALDFAARGETGVNLFSLRGELVEALPYARLRDEAMALAR
RLLAAGARPGDSVGLIAETDADFVRAFFACQYAGLPPAPLPLPAPLGGREAYIEQIARML
GSARASVLIGPASMAAWLPDIAARQPLRFAGALADLPEAEDADLPVIEPDRTCYLQFSSG
STRFPTGVVVTHRALMANAQAITRDGLKVRPDDRAISWLPLYHDMGLIGFLLSPMTSQMS
VDLLPTGAFVRRPLMWLDLMTRNGGTISYSPTFGYELCARRAEAASIEHLDLSRWRSAGL
GGDMIRTGPLRAFAERFKAVGFSDSAFVASYGMAEATLALSMSPLGEGLKVETLDVEQLE
QGLAVTSTDAGRSRDFARNGPVLPDHDLVVRDAAGQSLPERGVGRIFARGPSLMREYFEQ
PEETARVLSADGWLDTGDLGYLVEGEIVITGRGKDLIILNGRNIWPQDLEWTAEAEIDSL
RSGDVAAFSIPGDGEELVMVLVQARGGDAETRRALAEQVATVLRLRHSVETRVQLVGAHA
LPQTSSGKLSRSKAKAAFLAGAYAEQP
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgataactccgaccggcacctcgcgaacggttcgcttcgcagatttccccaccctgacg
gccgcgctggatttcgcagcccgcggcgagacgggcgtgaacctcttttccctgcgcggc
gagctggtcgaagccctgccctatgcgcgcctgcgcgacgaggcgatggccctggccagg
cgcctgctggccgccggagcccggcccggcgacagcgttggcctgatcgccgagaccgac
gccgatttcgttcgcgccttctttgcctgccagtatgccggtctgccgcccgctcccctg
cccctgccggcaccgctgggcggccgcgaggcctatatcgaacagatcgccaggatgctg
ggctcggcccgggcctctgtcctgatcggcccggcctcgatggcggcctggctgccggac
atcgctgcccgccagcccttgcggttcgccggtgccctggcggacctgcccgaggccgaa
gatgcggacctgccggtaatcgagcccgaccgcacctgctatctgcagttttcgtcgggc
agcacccgtttcccgaccggcgtcgtcgtgacccaccgcgccctgatggccaatgcccag
gccattacccgggacgggctgaaggtgcgccccgatgaccgggcgatctcctggctgccg
ctctatcacgacatgggcctgatcggcttcctgctgagccccatgaccagccagatgtcg
gttgacctgctgccgaccggggccttcgtccgccggccgctgatgtggctggacctgatg
acccgcaacgggggcacgatcagctacagtcccaccttcggctatgagctctgtgcccgc
cgggccgaggccgcgtcgatcgagcatctggatctgtcgcgctggcgcagcgccggactg
ggcggcgacatgatccgcaccgggccgctgcgggccttcgccgaacgcttcaaggccgta
ggtttctccgactccgccttcgtggccagctacggcatggccgaggccaccctggccctg
tcgatgtcacccctgggcgagggcctgaaggtcgagaccctggatgtcgagcagctggaa
cagggcctggcggtgaccagcaccgacgccggacgttcgcgggatttcgcccgcaatggc
ccagtcctcccggatcacgacctggtcgtccgcgacgcggccggacaatccctgcccgag
cgcggcgttggccggatctttgcccgtgggcccagcctgatgcgcgagtatttcgaacag
ccggaagagaccgcccgggtactgtcggccgacggttggctggacaccggtgacctcggc
tatctggtcgagggcgagatcgtcatcaccggccgcggcaaggacctgatcatcctcaat
ggccgcaatatctggccccaggacctggaatggaccgccgaggccgagatcgacagcctg
cgcagcggtgacgtcgccgccttctcgatccccggtgacggcgaagagcttgtcatggtc
ctggtccaggcccgtggcggtgacgcggagacccgcagggccctggccgaacaggtcgcg
accgtcctgcggctacgccatagcgtcgagacccgcgtgcaactggtcggggcccatgcc
ctgccccagacctcgtcgggcaagctcagccgctccaaggccaaggccgccttcctggcg
ggtgcctatgcggagcagccctga

DBGET integrated database retrieval system