KEGG   Caulobacter henricii: AQ619_16010Help
Entry
AQ619_16010       CDS       T04110                                 

Definition
(GenBank) catalase
  KO
K03781  catalase [EC:1.11.1.6]
Organism
chq  Caulobacter henricii
Pathway
chq00380  Tryptophan metabolism
chq00630  Glyoxylate and dicarboxylate metabolism
chq01100  Metabolic pathways
chq01110  Biosynthesis of secondary metabolites
chq01130  Biosynthesis of antibiotics
chq01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:chq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AQ619_16010
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    AQ619_16010
Enzymes [BR:chq01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     AQ619_16010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase-rel
Motif
Other DBs
NCBI-ProteinID: ALL14742
UniProt: A0A0P0P3C7
LinkDB All DBs
Position
complement(3413683..3415146)
Genome map
AA seq 487 aa AA seqDB search
MTDKFLTTTAGAPIADNQNSLSAGPRGPLLMQDYQLLEKLAHQNRERVPERVVHAKGSGA
YGTLTVTQDVTRWTKARFLSEVGKQTEILMRFSTVAGERGAADAERDVRGFSIKAYTEEG
NWDMVGNNTPVFFVRDPMKFPDFIRTQKRHPVTNLRSPTAMWDYWSLSPESLHQVTTLFS
DRGLPQGFRFMHGFGSHTYSFFNEANERVWVKFHFKSMQGIRTWTNAEGNAVIANDRESA
QRDLFEAIEAGDFPRWRFCIQVMTEAQAETFRWNPFDLTKVWPHADYPLIEVGIVELNRN
ADNYFAEIEQSSFSPSNVVPGIGFSPDKVLQARIFAYADAHRYRIGTHYEALPVNRPRCP
VNHQHADGAMRFDAPPRTNAWYEPNSFGGPVQDRRFAEPALPLSGDADRFDHRGISDDYT
QPGDLFRLMNADQQGQLFDNIAAAMHGVPVEIQTRQLVHFHRADPAYAAGVAQRLGVAFD
PAETAAA
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaagttcctgaccaccacagccggcgcgcccatcgccgacaatcagaattcg
cttagcgccggtccgcgcgggcccctgctgatgcaggactatcagctgctggaaaagctg
gcccaccagaaccgcgagcgcgtgcccgagcgcgtcgtccacgccaagggctcgggggcc
tatggcaccctgaccgtgacccaggacgtcacccgctggaccaaggccaggttcctgtcg
gaggtcggcaagcagaccgagatcctgatgcgcttctcgaccgtggccggcgagcgtggc
gcggccgacgccgagcgcgacgtgcgcggcttctcgatcaaggcctacaccgaggagggc
aactgggacatggtgggtaacaacacccccgtgttctttgtccgcgatccgatgaagttc
cccgacttcatccgcacccagaaacgccacccggtgaccaatctgcgctcgccgacggcc
atgtgggactactggtcgctgagccctgaaagcctgcaccaggtgaccaccctgttcagt
gatcgcggcctgccccagggcttccggttcatgcatggcttcggcagccacacctattcg
ttcttcaacgaggccaatgagcgggtgtgggtgaaattccacttcaagtcgatgcagggc
atccggacctggaccaatgcggagggcaatgccgtcatcgccaacgaccgcgagagcgcc
cagcgcgacctgttcgaggccatcgaggccggcgacttcccgcgctggaggttctgcatc
caggtgatgaccgaagctcaagcggagaccttccgctggaaccccttcgacctgaccaag
gtctggccgcatgcggactatccgctgatcgaggtcggcatcgtcgagctgaaccgcaat
gccgacaactatttcgccgagatcgagcagagctcgttctcgccctccaacgtcgtgccg
ggcatcggcttctcgcccgacaaggtgctgcaggcgcggatcttcgcctatgccgacgcc
caccgttaccggatcggcacccactatgaggccctgccggtcaaccgtccgcgctgcccg
gtcaaccaccagcacgccgacggtgcgatgcgcttcgatgcgcccccgcgcaccaatgcc
tggtacgagcccaactcgttcggcggtccggtgcaagacaggcgctttgccgagccggcc
ctgccgctgtccggtgacgccgaccgcttcgaccatcgcgggatcagcgacgactatacc
cagccgggcgacctgttccggctgatgaacgccgaccagcagggccagctgttcgacaat
atcgccgcggccatgcacggcgtgccggtcgagatccagacgcgccagctggtccatttc
caccgcgccgatccggcctatgccgccggcgtcgcccaaaggctcggggtcgccttcgac
cccgccgagaccgccgccgcatag

DBGET integrated database retrieval system