KEGG   Caulobacter henricii: AQ619_17685Help
Entry
AQ619_17685       CDS       T04110                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
chq  Caulobacter henricii
Brite
KEGG Orthology (KO) [BR:chq00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AQ619_17685
Enzymes [BR:chq01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AQ619_17685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_oxidored Thioredoxin_3 HI0933_like FAD_binding_2 AlaDh_PNT_C DAO FAD_binding_3 Thi4 NAD_binding_8 K_oxygenase NAD_binding_7 Glutaredoxin DUF3148 FMO-like
Motif
Other DBs
NCBI-ProteinID: ALL15044
UniProt: A0A0P0P375
LinkDB All DBs
Position
3776830..3778413
Genome map
AA seq 527 aa AA seqDB search
MLDDSLKTQLTAYLQNLRQPITLVASLDDSQGSRDMKALLEDVASTSDKVSLNLTGDDAR
RPSFAITRAAGDASVRFAGLPLGHEFTSLVLALLHVGGHPPRFEAELLDQVRALDGDYHF
ETYFSQSCQNCPDVVQALNTMSALNPRISHVAIDGALFQAEVEARQIMAVPTILLNGQPF
GQGRMDLEQILTKLDTGAADRAAEKIRSKDAFDVLVIGGGPAGAAAAIYAARKGIRTGIA
AERFGGQVLDTMAIENFISVSHTEGPKLVSGLEQHVKDYEVDIMNLQKAVGLVPARTPGG
LVEVKLENGASLMSRSVILSTGARWRNVNVPGEAEYKNRGVAYCPHCDGPLYKGKRVAVI
GGGNSGVEAAIDLAGIVAHVTLIEFDNQLRADAVLQRKLASLPNVAIVTSAMTSEIHGDG
SKVIGLSYKDRVSEAVHRLDLDGVFVQIGLVPNTEWLKDSGVALTPRGEIEVDQRGETSI
PGVFGAGDATTTPYKQIIIAMGEGAKASLSAFDYLIRLPTAETQAAA
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgacagcctgaagacccagctgaccgcctatctgcagaacctgcgtcaaccg
atcacgctcgtcgcctcgctggacgacagccagggttccagagacatgaaggccctgctc
gaggatgtggcctccacctccgacaaggtgagcctgaacctgacgggtgacgacgcccgc
aggccgtccttcgccatcacccgcgcggccggagatgcctcggtgcgtttcgcgggcctg
ccgctgggccatgaattcacctcgctggtgctggccctgctgcacgtcggcggtcacccg
ccccggttcgaggccgagctcctcgaccaggtcagggccctggacggcgactatcacttc
gagacctatttctcgcagtcctgccagaactgcccggacgtggttcaggccctcaacacc
atgagcgccctgaacccccgcatcagccatgtcgccatcgacggggccctgttccaggcc
gaggtcgaggcgcgccagatcatggccgtaccgaccatcctgctgaacggccagcccttc
ggccagggccgcatggatctcgaacagatcctgaccaagctggacaccggggcggccgac
cgggcggcggaaaagatcaggtccaaggacgccttcgatgttctggtgatcggtggcggc
ccggccggcgcggcagcggcgatctatgcggcccgcaagggcatccgcaccggcatagcg
gcagagcgcttcggcggtcaggtgctggacaccatggccatcgagaatttcatctcggtc
tcgcacaccgagggtcccaagctggtctcgggcctggagcagcacgtcaaggactatgag
gtcgacatcatgaacctgcagaaggctgtgggtctggtgccggcccgcaccccgggcggc
ctggtcgaggtcaagctagagaacggggccagcctgatgtcgcgcagcgtgatcctctcg
accggtgcccgctggcgcaatgtcaatgtgcccggcgaggccgagtacaagaaccgcggc
gtggcctattgcccccactgcgacggccccctctacaagggcaagcgcgtggcggtgatc
ggcggcggcaacagtggcgtcgaggctgccatcgacctggccggcatcgtcgcccatgtg
accctgatcgagttcgacaaccagcttcgtgccgatgcggtcctgcagcgcaaactggcc
agcctgcccaatgtcgccattgtcacctcggccatgaccagcgagatccacggcgacggc
agcaaggtcatcggtctcagctacaaggaccgggtcagcgaggcggtgcatcgcctcgat
ctcgacggcgttttcgtccagatcggcctcgtacccaataccgaatggctgaaggacagc
ggcgtggccctgaccccgcgcggcgagatcgaggtggatcaacgcggtgagacctcgatc
cccggggtattcggggccggggacgcgaccaccacgccttacaagcagatcatcatcgcc
atgggcgagggggccaaggcctcgctctcggcctttgactacctgatccgcctgccgacg
gccgagacccaggccgccgcctga

DBGET integrated database retrieval system