KEGG   Chromobacterium sp. IIBBL 274-1: DK843_15190Help
Entry
DK843_15190       CDS       T05744                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
chrb  Chromobacterium sp. IIBBL 274-1
Pathway
chrb00473  D-Alanine metabolism
chrb00550  Peptidoglycan biosynthesis
chrb01100  Metabolic pathways
chrb01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:chrb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    DK843_15190
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DK843_15190
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    DK843_15190
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:chrb01011]
    DK843_15190
Enzymes [BR:chrb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     DK843_15190
Peptidoglycan biosynthesis and degradation proteins [BR:chrb01011]
 Precursor biosynthesis
  Amino acid ligase
   DK843_15190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 ATP-grasp ATPgrasp_ST CPSase_L_D2 RimK ATPgrasp_YheCD TTL
Motif
Other DBs
NCBI-ProteinID: AXE35531
UniProt: A0A344UJT3
LinkDB All DBs
Position
3178286..3179197
Genome map
AA seq 303 aa AA seqDB search
MKQYGKVAVLMGGSSSEREVSLMSGAGVLAALQSKGVDAHRFDPSEKPLSALKEEGFDCV
FNILHGPFGEDGTVQGALEALAVPYTGCGVMASAIAMDKWRTKLLWKGAGLPIPAFELLD
ESSDFDAIEKALGLPIFVKPSTEGSSIGVTKVKRPGELRAAFEEARKYDDVVIAEQFIGG
GEYTCAVIGETAYPTIKIEPATEYYDYQAKYFRDDTVYRCPSGLAPEVEARARELALKAF
KVLGCRGWSRVDFLMDDAGEIYLLEANTSPGMTSHSLVPMAARAEGIAYEDLCLKVLDTV
HVG
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagtacggcaaagtggcggtgttgatgggcgggagctcgtccgagcgcgaagtg
tcgctgatgagcggcgccggggtgctggcggcgctgcagtccaagggcgtggacgcccat
cggttcgatccgtcggaaaagccgttgtcggcgttgaaggaagaaggtttcgactgcgtg
ttcaacatcctgcacggccccttcggcgaggacggcaccgtgcagggcgcgctggaagcg
ctggccgtgccgtacaccggctgcggcgtgatggcctcggccatcgccatggacaagtgg
cgcaccaagctgttgtggaagggcgcgggcttgccgatcccggctttcgaactgctggac
gagagcagcgatttcgatgcgatcgaaaaggcgctgggcctgcccatcttcgtcaagccg
tcgaccgaaggctcgagcatcggcgtgaccaaggtgaagcggccgggcgagttgcgcgcg
gcgtttgaagaggcgcgcaagtacgacgacgtggtgatcgccgagcagttcatcggcggc
ggcgaatacacctgcgcggtgatcggcgagacggcctacccgacgatcaagatcgagccg
gccaccgaatattacgactaccaggccaagtatttccgcgacgacacggtctaccgttgc
ccgtccggcctcgcgccggaagtggaggcccgggcgcgcgagctggctttgaaggcgttc
aaggtattgggttgccgcggctggagccgggtggacttcctgatggacgacgcgggcgag
atttatctgctggaagcgaataccagcccaggcatgaccagccatagcctggtgccgatg
gcggcgcgggcggaaggcatcgcttacgaagacctgtgtctgaaggtattggatacggtg
catgtgggataa

DBGET integrated database retrieval system