KEGG   Chromobacterium sp. IIBBL 112-1: DK842_02385Help
Entry
DK842_02385       CDS       T05549                                 

Definition
(GenBank) amylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
chri  Chromobacterium sp. IIBBL 112-1
Pathway
chri00500  Starch and sucrose metabolism
chri01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:chri00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DK842_02385
Enzymes [BR:chri01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     DK842_02385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N CBM_20 Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: AXE28864
LinkDB All DBs
Position
477197..479821
Genome map
AA seq 874 aa AA seqDB search
MKQPSLIRPALLGLLIASLFSPLAHAGEAFGSPGNAPVRGPASKSFLGTAVGGPSKVYFT
GYRGIVSEVYYPVLDTPESVDLQFLVGDAGKTFVDEEKQQAYSASQTDKRTMSWIASTGN
AGHNWRISKRIFVDPARDALVQRVTFSALNGRKLGDFNLYLLFKPCLDNSGAGNNAQTVA
AAGGYALAASRNSRASALMASQPWKTVNGQPMLSNGFVGQSDGWTDLVGSGDNAMNWTFS
SASGGNVAQTGWLDLGDPNATSVSFDVVLAFGKSQGEAVNAAAASLGSDLAAAQRQYDDG
WHAYAAGLSAQGGLADDRYYLAAMTLKTMQDKSNGAMIAGIGTPWGETQGDANQGGYHLV
WPRDLFKFANALTTAGDTATATTVVNYLFNTLQQTSNCGAAEYNAAGCAAGYSRVGRFPQ
NAWVSGWPYWQGTQMDEQAMPILLAWRLGSVVSNPLWPKIKLTADYIVATGPWSYQERWE
ENSGYSPSTLAAEIAGLVAAADIARANGDDASAGRYLSAADYWQQSVAAWTYTTSGGFGN
GSYYVRVNPASRAGSGTDRASFRPIAGPDTPQTVTVKNGGGDRDARRVVDGGFLELVRMG
VKRADDPTIVNTMAVFDSVLGQKLALPGAPSLPVNAWFRYNFDGYGEHNDGRDFDGAGVG
RLWPIFTAERGMYEIARQGKASAGQPYLATLKLLATPEGMLPEQVWSNSATLPDGWTVTT
PAGYQAGAATKSMGPLNWAMGEYISLLASIHAGKVVDIPQVVCARYNNCRAAPKAGEVPV
GINVTASTQWGQQVYVTGNARALGNWNTDLGLPVDAVNYPVWQNGVNLPAGQPIAYKYYR
KNADGSVTWENLSGNRSLLTPASGSLSLNDQVSW
NT seq 2625 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaccgtccctgatccgtccggccttgctgggcctgctgatcgccagcctgttc
agcccacttgcccacgccggcgaagccttcggctcgcccggcaacgcgccggttcgaggc
ccggcgtccaagtccttcctcggcacggccgtcggcggcccctccaaggtttacttcacc
ggctaccgcggcatcgtgtccgaggtgtactacccggtgctggacacgccggaatcggtg
gacctgcagtttctggtgggcgacgccggcaagaccttcgtcgacgaggagaaacagcag
gcgtattcggccagccaaaccgacaagcgcaccatgagctggatcgccagcaccggcaac
gccggccacaactggcggatcagcaagcgcatcttcgtcgatccggcccgcgacgcgctg
gtgcagcgcgtcaccttcagcgcgctgaatggccgcaagctgggcgacttcaacctctac
ctgctgttcaagccttgcctggacaacagcggcgccggcaacaatgcccagaccgtggcc
gccgccggcggctacgcgctggccgccagccgcaacagccgcgcctcggcgctgatggcc
agccagccgtggaaaaccgtcaacggccaacctatgctgtccaacggtttcgtcggccag
agcgacggctggaccgatcttgtcggcagcggcgacaacgcgatgaactggaccttcagc
tccgccagcggcggcaacgtggcgcagacaggctggctggacctgggcgacccgaacgcc
accagcgtgtccttcgacgtggtgctggccttcggcaagagccagggcgaagcggtcaac
gccgccgccgcctcgctgggctccgaccttgccgccgcccagcggcaatacgacgatggc
tggcacgcctacgccgccggcctgtccgcccagggcggcctggccgacgaccgctactat
ctggcggcgatgacgctgaaaaccatgcaggacaagagcaacggcgccatgatcgccggc
atcggcacgccatggggcgaaacccagggcgacgccaaccagggcggttaccacctggtg
tggccgcgcgacctgttcaagttcgccaacgccctgaccacggccggcgacaccgccacc
gccacgaccgtagtcaattacctgttcaataccctgcagcaaaccagcaactgcggcgcg
gccgaatacaacgccgccggttgcgccgccggctacagccgcgtcggccgcttcccgcaa
aacgcctgggtcagcggctggccgtactggcaaggcacgcagatggacgaacaggccatg
cccatcctgctggcctggcggctggggtcggtcgtgtccaatcccttgtggcccaaaatc
aagctgaccgcggactacatagtcgccaccggaccatggagctaccaggaacgctgggag
gaaaactccggctactcgccgtccaccctcgccgccgagatcgccggcctggtggctgcc
gccgacatcgcccgcgccaacggcgacgacgccagcgccggccgctacctctccgccgcc
gattactggcagcaaagcgtcgccgcctggacctacaccaccagcggcggcttcggcaat
ggaagctactatgtccgcgtcaacccggccagccgcgccggcagcggaaccgaccgcgcc
agcttccggcccatcgccggcccagacacgccgcaaaccgtcaccgtgaagaacggcggc
ggcgaccgcgatgcccgccgcgtggtggacggcggcttcctggaactggtgcgcatgggc
gtcaaacgcgccgacgatcccaccatcgtcaacaccatggccgtgttcgacagcgtgctg
ggccagaaactggcgctgcccggcgcgccatccttgccggtcaacgcctggttccgctac
aacttcgacggctacggcgaacacaacgacggccgcgacttcgacggcgcgggcgttggc
cggctgtggcccatcttcaccgccgagcgcggaatgtacgagatcgcccgccagggcaag
gcctcggccggtcagccttatctcgccacgctgaagctgctggccacgccggaaggcatg
ctgccggaacaagtgtggtccaacagcgccacgctgccagacggctggacggtgaccacg
ccggccggctaccaagccggcgccgccaccaaatcgatggggccgttgaactgggcgatg
ggcgaatacatcagcctcttggcctcgatccatgccggcaaggtggtcgacattccgcag
gtggtctgcgcccgctacaacaactgccgcgccgcgcccaaggccggcgaggtgccggtc
ggcatcaacgtgacggccagcacgcagtggggccagcaggtctacgtcaccggcaacgcg
cgggcgctgggcaactggaacaccgacctcggtcttccggttgatgcggtcaactacccg
gtatggcaaaacggcgtcaaccttccggccggccagcccatcgcctacaagtactaccgc
aagaacgccgacggcagcgtgacttgggagaacctgtccggcaaccgcagcctgctgacg
ccggccagcggcagcctcagcctgaatgatcaggtgagctggtga

DBGET integrated database retrieval system