KEGG   Chromobacterium sp. IIBBL 112-1: DK842_03785Help
Entry
DK842_03785       CDS       T05549                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase FabI
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
chri  Chromobacterium sp. IIBBL 112-1
Pathway
chri00061  Fatty acid biosynthesis
chri00780  Biotin metabolism
chri01100  Metabolic pathways
chri01130  Biosynthesis of antibiotics
chri01212  Fatty acid metabolism
Module
chri_M00083  Fatty acid biosynthesis, elongation
chri_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:chri00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    DK842_03785
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    DK842_03785
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    DK842_03785
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:chri01004]
    DK842_03785
Enzymes [BR:chri01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     DK842_03785
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     DK842_03785
Lipid biosynthesis proteins [BR:chri01004]
 Fatty acid synthase
  Component type
   DK842_03785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Polysacc_synt_2
Motif
Other DBs
NCBI-ProteinID: AXE32543
LinkDB All DBs
Position
758509..759285
Genome map
AA seq 258 aa AA seqDB search
MESIRNILAGKRGLIVGIANENSIAYGCASVLHQLGAECAVTYLNAKAEKYVRPLAEQLQ
ASLVLPLDVEQPGQLERVFAEIEKRWGGLDFIVHSIAYCPMEDLHGRVVDCSLAGFQQAM
HVSCYSFIEMARLAEPLMKNGGSLITMSYYGADKVVENYNIMGPVKAALESVSRYLANDL
GPKRIRVHAVSPGPLKTRAASGIAHFDQLIEDAIAHAPQNRLVEIEEVGMTCAFLISDAA
SGLTGQTIYVDGGHHIKA
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcatacgcaacattctcgccggcaagagagggctcatcgtcggcatcgccaac
gaaaacagcatcgcctacggctgcgccagcgtgctgcaccagctgggggccgagtgcgcg
gtcacctatctcaacgccaaagccgagaaatacgtgcggccgctggccgaacagctgcag
gccagcctggtgctgccgctggacgtggagcagcccggccagctggaacgcgtgttcgcc
gagatagaaaagcgctggggagggctggatttcatcgtccactccatcgcctattgtccg
atggaagacctgcacggccgggtggtggactgctcgctggcgggcttccagcaggccatg
cacgtctcttgctactccttcatcgaaatggcccgcctggctgagccgctgatgaaaaac
ggcggcagcctgatcaccatgagctactacggcgcggacaaggtggtggaaaactacaac
atcatgggcccggtcaaggccgcgctggagagcgtgtcccgctacctggccaatgacctc
ggccccaagcgcatccgcgtgcacgccgtctcgcccggcccgctgaagacgcgcgccgcg
tccggcatcgcccatttcgaccagttgatcgaagacgccatcgcccacgcaccgcaaaat
cgcctggtggagatagaggaagtcggcatgacctgcgccttcctgatatccgacgccgcc
agcggcctcaccggccagaccatctacgttgacggcggacaccacatcaaggcttga

DBGET integrated database retrieval system