KEGG   Chromobacterium sp. IIBBL 112-1: DK842_08065Help
Entry
DK842_08065       CDS       T05549                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
chri  Chromobacterium sp. IIBBL 112-1
Pathway
chri00564  Glycerophospholipid metabolism
chri01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:chri00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    DK842_08065
Enzymes [BR:chri01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     DK842_08065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 Pyr_redox_2 FAD_oxidored NAD_binding_8 FAD_binding_2 STPPase_N 3HCDH_N GIDA
Motif
Other DBs
NCBI-ProteinID: AXE29848
LinkDB All DBs
Position
complement(1707317..1708828)
Genome map
AA seq 503 aa AA seqDB search
MEIYDLVIIGGGINGAGIARDAAGRGMSVLLCEKDDLASHTSSASTKLIHGGLRYLEYYE
FGLVRKALQEREVLLKAAPHIIWPLRFVMPHARDQRPEWMIRCGLFLYDHLARREVLPGS
ETVSFSRHPAGGPLKADFKRGFVYSDGWVQDARLVVLNAMDAAEHGARIHTRTACVAARR
DGEHWLATLEREDGSRFEVRARALVNAAGPWVQSLIEDKLAMPSSKSIRLVKGSHIVVKK
IFDHPFAYIFQNPDKRIIFAIPYEKDFTLIGTTDVEYRGDPNEVAIDGDEIRYLCEMSNR
YFHSQIAPDDVLSTYSGVRPLLDDASDNASSVTRDYALEMDLQGAPLLSVFGGKITTFRK
LAEEAVDKVAPLLGCGKATWTADAPLPGGDMPGADFGRFLQGLRQRHPWLPEALAERWAR
AYGTRVAKLIGKAGNLDGLGKEVLPGLYEAELAYLADAEWATRSEDILWRRSKLKLHLPA
NAAEVVDAWLAARAQPPREALSA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
gtggaaatttacgatctggtaatcataggcggcggcatcaacggcgcgggcatcgcgcgc
gacgccgccgggcgcggcatgtcggtgctgctgtgcgagaaggacgacctggcttctcat
acctcgtcggccagcaccaagctgatccacggcgggctgcgctacctggaatattatgag
ttcggcctggtgcgcaaggcgctgcaggagcgcgaggtgctgctgaaggccgccccgcac
atcatctggccgctgcgcttcgtgatgccgcacgcgcgggaccagcgtccggagtggatg
atccgctgcggcctattcctgtacgaccacctggcccgccgcgaagtgctgcccggctcg
gagaccgtcagcttctcccgccacccggccggcggtccgttgaaggccgacttcaagcgc
ggcttcgtctattccgacggctgggtgcaggacgcgcggctggtggtgctcaacgcgatg
gacgcggccgagcacggcgcccgcatccacacccgcaccgcctgcgtcgccgcccgccgc
gatggcgaacattggctggccacgctggaacgggaggatggcagccgcttcgaagtgcgc
gcccgcgcgctggtcaacgccgccggcccctgggtgcagagcctgatcgaggacaagctg
gcgatgccgtccagcaagtccatccgcctggtcaagggcagccacatcgtggtgaagaag
attttcgaccacccgttcgcctacattttccagaacccggacaagcgcatcatcttcgcc
attccgtacgagaaggacttcacgctgatcggcaccaccgacgtcgaataccggggcgat
ccgaacgaggtggcgatagacggcgacgaaatccgctacctgtgcgagatgagcaaccgc
tatttccacagccagatcgcgccggacgacgtgctgtccacctattccggcgtgcgcccg
ctgctggacgacgcgtccgacaacgcctccagcgtcacccgcgactacgcgttggaaatg
gacctgcaaggcgcgccgctgttgtcggtgttcggcggcaagatcaccaccttccgcaag
ctggcggaggaggcggtggacaaggtggcgccgctgctgggctgcggcaaagccacctgg
accgccgacgcgccgttgccgggcggcgacatgccgggcgcggatttcggccgtttcctg
caaggcctgcgccagcgccatccgtggctgccggaggcgttggcggagcgctgggcccgc
gcctacggcacccgcgttgccaagctgatcggcaaggcgggcaacctggacggcctgggc
aaggaggtgctgccgggcctgtatgaagccgagctggcctatctggccgacgccgagtgg
gcgacccgcagcgaggacatcctgtggcggcgctccaagctgaagctgcacctgccggcc
aatgccgccgaggtggtggatgcctggctggccgcgcgcgcgcagccgccgcgagaggcg
ctgagcgcctga

DBGET integrated database retrieval system