KEGG   Chromobacterium sp. ATCC 53434: CXB49_03075Help
Entry
CXB49_03075       CDS       T05234                                 

Definition
(GenBank) NADP-dependent isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
chro  Chromobacterium sp. ATCC 53434
Pathway
chro01100  Metabolic pathways
chro01110  Biosynthesis of secondary metabolites
chro01120  Microbial metabolism in diverse environments
chro01130  Biosynthesis of antibiotics
chro01200  Carbon metabolism
chro01210  2-Oxocarboxylic acid metabolism
chro01230  Biosynthesis of amino acids
Module
chro_M00009  Citrate cycle (TCA cycle, Krebs cycle)
chro_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:chro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CXB49_03075
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CXB49_03075
Enzymes [BR:chro01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CXB49_03075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: AUH49885
UniProt: A0A2H5DS52
LinkDB All DBs
Position
complement(676891..679128)
Genome map
AA seq 745 aa AA seqDB search
MPAEQSKIIYTLTDEAPALATSSFLPIVQAFAGSAGVQVDTADISVAARVLAEFPDYLTE
EQQVPNTLSELGKLTLQPEANIIKLPNISASVAQLAACVKELQAKGYKLPDYPENPASDA
EKAIKDRYAKCLGSAVNPVLREGNSDRRAPLAVKNYAKKHPHSMAEWKQWSQTHVSHMHH
GDFYHGEKSITLDKAREVKMELATTSGQTIVLKSKVALQDGEIIDSMFMSKKALCDFYER
EMEDCREAGILFSLHVKATMMKVSHPIVFGHCVKIYYKDAFEKHGKLFDELGVNVNNGMA
TLYEKIETLPASKREEIIRDLHACQEHRPRLAMVDSAKGITNFHSPNDVIVDASMPAMIR
AGGKMWGADGKPYDCKAVMPESTFARIYQEMINFCKWHGNFDPKTMGTVPNVGLMAQKAE
EYGSHDKTFEIKEDGVANIVDLATGEVLLSQSVEAGDIWRMCQVKDAPIRDWVKLAVTRA
RNSGMPAVFWLDPYRPHENELIKKVKTYLKDYDTSGLEIQIMSQVRAMRYTLERVARGLD
TISVTGNILRDYLTDLFPIMELGTSAKMLSIVPLIAGGGMYETGAGGSAPKHVQQLLEEN
HLRWDSLGEFLALAVSLEDLGIKTGNDKAKILAKTLDAATGKLLDNNKSPSRRTGELDNR
GSQFYLAKYWAQALAEQADDKELQARFAPVAKQLADAEQQILAELKAVQGQAADIGGYYL
PDADKCQAVMRPSATFNAAIDAVQA
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcagaacaatcgaaaatcatctacacccttaccgacgaagcgccggcgctggcc
accagttccttcctgcccatcgtccaggccttcgccggttcggccggcgttcaggtcgat
actgccgacatctccgtggccgcccgcgtactggcggaattccccgattacctgaccgaa
gagcaacaggtcccgaataccctgtccgagctcggcaagctgacgctgcagccggaagcc
aacatcatcaagctgcccaacatcagcgcgtccgtcgcccagctggcagcctgcgtcaag
gaactgcaggccaagggctacaagctgcccgactatccggagaacccggccagcgacgcc
gagaaggcgatcaaggaccgctacgccaaatgcctgggctccgcggtgaacccggtgctg
cgcgaaggcaactccgaccgccgcgcgccgctggcggtgaagaactacgcgaagaagcac
ccgcactcgatggccgaatggaagcagtggtcgcagacccacgtctcccacatgcaccac
ggcgacttctaccacggcgaaaaatccatcacgctggacaaggcgcgcgaagtcaagatg
gagctggcgaccaccagcggccagaccatcgtgctgaaatcgaaggtggcgctgcaggac
ggcgagatcatcgactcgatgttcatgagcaagaaggcgctgtgcgacttctacgagcgc
gagatggaagactgccgcgaggccggcatcctgttttccttgcacgtgaaggccacgatg
atgaaggtgtcccaccccatcgtgttcggccactgcgtcaagatctactacaaggacgcg
ttcgagaagcacggcaagctgttcgacgagctgggcgtcaacgtcaataacggcatggcc
acgctgtacgagaagatcgagacgctgccggcctcgaagcgcgaagaaatcatccgcgac
ctgcacgcctgccaggaacaccgtccgcgcctggcgatggtcgactccgccaagggcatc
accaacttccactcgccgaacgacgtcatcgtcgacgcctcgatgccggcgatgatccgc
gccggcggcaagatgtggggcgccgacggcaagccgtacgactgcaaggccgtgatgccg
gaatcgaccttcgcccgcatctatcaggagatgatcaacttctgcaaatggcacggcaac
ttcgatccgaagaccatgggcaccgtgcccaatgtcggcctgatggcgcagaaggccgag
gaatacggctcgcacgacaagaccttcgagatcaaggaagacggcgtcgccaacatcgtc
gacctcgccaccggcgaagtgctgctgtcgcaaagcgtggaagccggcgacatctggcgc
atgtgccaggtgaaggacgcgcctatccgcgactgggtgaagctggccgtgacccgcgcc
cgcaactccggcatgccggcggtgttctggctggacccgtaccgcccgcacgagaacgag
ctgatcaagaaggtgaagacctatctgaaggactacgatacctcgggcctggaaatccag
atcatgtcgcaggtgcgcgcgatgcgctacacgctggaacgcgtggcccgcggcctggac
accatctcggtcaccggcaacatcctgcgcgactacctgaccgacctgttccccatcatg
gaactgggcacctcggccaagatgctgtccatcgtgccgctgatagccggcggcggcatg
tacgaaaccggcgcaggcggctcggcgccgaaacacgtgcaacagctgctggaagagaac
cacctgcgctgggacagcctgggcgagttcctggcgctggcggtgtcgctggaagacctg
ggcatcaagaccggcaacgacaaggccaagatcctggccaagacgctggacgcggccacc
ggcaagctcttggacaacaacaagtccccgtcgcgccgcaccggcgaactggacaaccgc
ggcagccagttctacctggcgaagtactgggcacaggcgctggccgaacaggccgacgac
aaggaactgcaggcccgcttcgcgcccgtcgccaagcagctggccgacgccgagcagcaa
atcctggccgaactgaaggccgtgcagggccaggctgccgacatcggcggctactacctg
ccggacgcggacaagtgccaggcggtgatgcgcccgagcgccaccttcaacgccgccatc
gacgccgtgcaggcctga

DBGET integrated database retrieval system