KEGG   Chromobacterium sp. ATCC 53434: CXB49_03075Help
Entry
CXB49_03075       CDS       T05234                                 

Definition
(GenBank) NADP-dependent isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
chro  Chromobacterium sp. ATCC 53434
Pathway
chro00020  Citrate cycle (TCA cycle)
chro00480  Glutathione metabolism
chro01100  Metabolic pathways
chro01110  Biosynthesis of secondary metabolites
chro01120  Microbial metabolism in diverse environments
chro01130  Biosynthesis of antibiotics
chro01200  Carbon metabolism
chro01210  2-Oxocarboxylic acid metabolism
chro01230  Biosynthesis of amino acids
Module
chro_M00009  Citrate cycle (TCA cycle, Krebs cycle)
chro_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:chro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CXB49_03075
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CXB49_03075
Enzymes [BR:chro01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CXB49_03075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: AUH49885
UniProt: A0A2H5DS52
LinkDB All DBs
Position
complement(676891..679128)
Genome map
AA seq 745 aa AA seqDB search
MPAEQSKIIYTLTDEAPALATSSFLPIVQAFAGSAGVQVDTADISVAARVLAEFPDYLTE
EQQVPNTLSELGKLTLQPEANIIKLPNISASVAQLAACVKELQAKGYKLPDYPENPASDA
EKAIKDRYAKCLGSAVNPVLREGNSDRRAPLAVKNYAKKHPHSMAEWKQWSQTHVSHMHH
GDFYHGEKSITLDKAREVKMELATTSGQTIVLKSKVALQDGEIIDSMFMSKKALCDFYER
EMEDCREAGILFSLHVKATMMKVSHPIVFGHCVKIYYKDAFEKHGKLFDELGVNVNNGMA
TLYEKIETLPASKREEIIRDLHACQEHRPRLAMVDSAKGITNFHSPNDVIVDASMPAMIR
AGGKMWGADGKPYDCKAVMPESTFARIYQEMINFCKWHGNFDPKTMGTVPNVGLMAQKAE
EYGSHDKTFEIKEDGVANIVDLATGEVLLSQSVEAGDIWRMCQVKDAPIRDWVKLAVTRA
RNSGMPAVFWLDPYRPHENELIKKVKTYLKDYDTSGLEIQIMSQVRAMRYTLERVARGLD
TISVTGNILRDYLTDLFPIMELGTSAKMLSIVPLIAGGGMYETGAGGSAPKHVQQLLEEN
HLRWDSLGEFLALAVSLEDLGIKTGNDKAKILAKTLDAATGKLLDNNKSPSRRTGELDNR
GSQFYLAKYWAQALAEQADDKELQARFAPVAKQLADAEQQILAELKAVQGQAADIGGYYL
PDADKCQAVMRPSATFNAAIDAVQA
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcagaacaatcgaaaatcatctacacccttaccgacgaagcgccggcgctggcc
accagttccttcctgcccatcgtccaggccttcgccggttcggccggcgttcaggtcgat
actgccgacatctccgtggccgcccgcgtactggcggaattccccgattacctgaccgaa
gagcaacaggtcccgaataccctgtccgagctcggcaagctgacgctgcagccggaagcc
aacatcatcaagctgcccaacatcagcgcgtccgtcgcccagctggcagcctgcgtcaag
gaactgcaggccaagggctacaagctgcccgactatccggagaacccggccagcgacgcc
gagaaggcgatcaaggaccgctacgccaaatgcctgggctccgcggtgaacccggtgctg
cgcgaaggcaactccgaccgccgcgcgccgctggcggtgaagaactacgcgaagaagcac
ccgcactcgatggccgaatggaagcagtggtcgcagacccacgtctcccacatgcaccac
ggcgacttctaccacggcgaaaaatccatcacgctggacaaggcgcgcgaagtcaagatg
gagctggcgaccaccagcggccagaccatcgtgctgaaatcgaaggtggcgctgcaggac
ggcgagatcatcgactcgatgttcatgagcaagaaggcgctgtgcgacttctacgagcgc
gagatggaagactgccgcgaggccggcatcctgttttccttgcacgtgaaggccacgatg
atgaaggtgtcccaccccatcgtgttcggccactgcgtcaagatctactacaaggacgcg
ttcgagaagcacggcaagctgttcgacgagctgggcgtcaacgtcaataacggcatggcc
acgctgtacgagaagatcgagacgctgccggcctcgaagcgcgaagaaatcatccgcgac
ctgcacgcctgccaggaacaccgtccgcgcctggcgatggtcgactccgccaagggcatc
accaacttccactcgccgaacgacgtcatcgtcgacgcctcgatgccggcgatgatccgc
gccggcggcaagatgtggggcgccgacggcaagccgtacgactgcaaggccgtgatgccg
gaatcgaccttcgcccgcatctatcaggagatgatcaacttctgcaaatggcacggcaac
ttcgatccgaagaccatgggcaccgtgcccaatgtcggcctgatggcgcagaaggccgag
gaatacggctcgcacgacaagaccttcgagatcaaggaagacggcgtcgccaacatcgtc
gacctcgccaccggcgaagtgctgctgtcgcaaagcgtggaagccggcgacatctggcgc
atgtgccaggtgaaggacgcgcctatccgcgactgggtgaagctggccgtgacccgcgcc
cgcaactccggcatgccggcggtgttctggctggacccgtaccgcccgcacgagaacgag
ctgatcaagaaggtgaagacctatctgaaggactacgatacctcgggcctggaaatccag
atcatgtcgcaggtgcgcgcgatgcgctacacgctggaacgcgtggcccgcggcctggac
accatctcggtcaccggcaacatcctgcgcgactacctgaccgacctgttccccatcatg
gaactgggcacctcggccaagatgctgtccatcgtgccgctgatagccggcggcggcatg
tacgaaaccggcgcaggcggctcggcgccgaaacacgtgcaacagctgctggaagagaac
cacctgcgctgggacagcctgggcgagttcctggcgctggcggtgtcgctggaagacctg
ggcatcaagaccggcaacgacaaggccaagatcctggccaagacgctggacgcggccacc
ggcaagctcttggacaacaacaagtccccgtcgcgccgcaccggcgaactggacaaccgc
ggcagccagttctacctggcgaagtactgggcacaggcgctggccgaacaggccgacgac
aaggaactgcaggcccgcttcgcgcccgtcgccaagcagctggccgacgccgagcagcaa
atcctggccgaactgaaggccgtgcagggccaggctgccgacatcggcggctactacctg
ccggacgcggacaagtgccaggcggtgatgcgcccgagcgccaccttcaacgccgccatc
gacgccgtgcaggcctga

DBGET integrated database retrieval system