KEGG   Chromobacterium sp. ATCC 53434: CXB49_04095Help
Entry
CXB49_04095       CDS       T05234                                 

Definition
(GenBank) amylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
chro  Chromobacterium sp. ATCC 53434
Pathway
chro00500  Starch and sucrose metabolism
chro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:chro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CXB49_04095
Enzymes [BR:chro01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     CXB49_04095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N CBM_20 Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: AUH50057
UniProt: A0A2H5DSN7
LinkDB All DBs
Position
complement(877229..879853)
Genome map
AA seq 874 aa AA seqDB search
MSHRSLSRPALLGILIAGLFAPAAQAAEAFGAPGDAPVRGPAAKSFVGTAVNSPSRVYFT
GYRGIVSEVYYPVLDTPESVDLQFLVGDAGRTFVDEEKRQAYAAGQSDTRTMSWIASTGN
DSHNWRISKRIFADPARDALVQRVTFTALNGRTVGDFNVYTLFKPYLDNAGAGNSAQTVA
TAGGYALAASHNSRASALMASRPWKTVNGQAMLSNGFVGNSDGWTDLIGSGDQAMNWTYG
SASNGNVAQMGWLDLGDPTANSVSFDVVLGFGKSQGDAVNTAAASLGGDLSVAQQQYDQA
WHAYAAGLSTQGGLADDRYYLAAMTLKTMQDKSNGAMIAGIGTPWGETQGDANQGGYHLV
WPRDLFKFANALYTAGDAATASAVVGYLFNTLQQRSDCGAAEYNAPGCAAGYSRVGRFPQ
NAWISGWPYWQGTQMDEQAMPILLAWRLGTTVSNPLWPKIKLTADYIVSTGPWSYQERWE
ENAGYSPPTIAAEIAGLVAAADIARANGDDASAGRYLSAADYWQQNVAAWTYTSSGGFGN
GSYYIRINPANRSGAGADRASFNPSAGPDAPQTLTVKNGGGSHDARRVVDGGFLELVRMG
VKRADDPTIVNTISVFDSVLGQYLALPGAPRLPANAWFRYNFDGYGEHNDGGDFDGAGVG
RLWPIFTAERGMYEIARQGAGGAGQPYFATLKLLATPEGMLPEQVWSNSATLPDGWAVTT
PVGYRPGSATKSMGPLNWAMGEYISLLASINAGRVIDIPQVVCARYNNCRAAPKAGEVAV
AINAGAAMQWGQQLYVTGDARQLGGWNTDLGIPLDAAAYPSWRNGVNLPAGQKIAYKYYR
KNADGSVVWESLTGNRSLQTPASGGLNLNDQVGW
NT seq 2625 nt NT seq  +upstreamnt  +downstreamnt
atgtcccatcggtccctgagccgccccgccctgctgggcatcctgatcgccggcctgttc
gctccggcggcgcaagccgcggaagcctttggcgcgcccggcgacgcgccagtccgcggt
ccggccgccaagtccttcgtcggcaccgcggtgaacagcccttcccgcgtctacttcacc
ggctaccgcggcatcgtgtccgaggtctactacccggtgctggacacgccggaatcggtg
gatctgcaattcctggtcggcgacgccggccggaccttcgtcgacgaggaaaaacgccag
gcctacgccgccggccagagcgacacgcgcacgatgagctggatcgccagcaccggcaac
gacagccacaactggcggatcagcaagcgcatcttcgccgatcccgcccgcgacgcgctg
gtgcagcgcgtgaccttcaccgcgctgaacggccgtaccgtcggcgacttcaatgtctac
acgctgttcaagccctatctggacaacgccggcgccggcaacagcgcccagaccgtggcc
accgccggcggctacgcgctggccgccagtcataacagccgcgcgtcggcgctgatggcc
agccggccgtggaaaaccgtcaacggccaggcgatgctgtccaacggcttcgtcggcaac
agcgacggctggaccgatctgataggcagcggcgaccaggcgatgaactggacctacggc
tcggccagcaacggcaatgtcgcgcagatgggctggctggatctgggcgatccgacggcg
aacagcgtgtccttcgacgtggtgctgggcttcggcaagagccagggcgacgccgtcaac
accgcagccgcctcgctgggcggcgacctctccgtcgcccagcaacagtacgaccaggcc
tggcatgcctatgccgccggcctgtccacccagggcggcctggccgacgaccgctactat
ctggcggcgatgacgctgaagacgatgcaggacaagagcaacggcgcgatgatcgccggc
atcggcacgccgtggggcgagacccagggcgacgccaatcagggcggctaccacctggtg
tggccgcgcgacctgttcaaattcgccaacgccctctataccgccggcgacgccgccacc
gcgagcgcggtggtcggctatctgttcaacacgctgcagcagcgcagcgactgcggcgcg
gccgagtacaacgcgcccggctgcgccgccggctacagccgcgtcggccgctttccgcaa
aatgcctggatcagcggctggccgtactggcagggcacgcagatggacgagcaggcgatg
cccatcctgctggcctggcggctgggcactacggtgtccaatccgctctggcccaagatc
aagctgaccgccgactacatcgtttccaccggtccgtggagctaccaggagcgctgggag
gagaatgccggctactcgccgcccaccatcgccgccgagatcgccggcctggtggccgcc
gccgacatcgcccgcgccaacggcgacgacgccagcgccggccgctatctgtccgccgcc
gactactggcagcagaacgtcgccgcctggacctacaccagcagcggtggcttcggcaac
ggcagctactacatccggatcaatccggccaatcgctcgggcgccggcgccgaccgcgcc
agcttcaatccgtcggccgggccggacgcgccgcagacgctgacggtcaagaacggcggc
ggcagccacgacgcgcgccgcgtcgtcgacggcggcttcctcgaactggtgcggatgggt
gtcaagcgcgccgacgacccgaccatcgtcaacaccatatcggtgttcgacagcgtgctc
ggccagtatctggcgctgcccggcgcgcccaggctgccggccaacgcctggttccgctac
aacttcgatggctacggcgagcacaacgacggcggcgacttcgacggcgccggcgtcggc
cggctgtggccgatcttcaccgccgagcgcggcatgtacgagatcgcccgccagggcgcc
ggcggcgccggccaaccgtacttcgccacgctgaagctgctggccacgccggaaggcatg
ctgccggagcaggtgtggtcgaacagcgcgacgctgccggacggctgggcggtgacgacg
ccggtcggctaccggccgggcagcgccaccaagtcgatgggaccactgaactgggcgatg
ggcgaatacatcagcctgttggcctcgatcaacgccggccgcgtgatcgacatcccgcag
gtggtctgcgcgcgctacaacaactgccgcgccgcgcccaaggccggcgaggtggcggtg
gccatcaacgccggcgccgccatgcaatggggccagcagctctacgtcaccggcgacgcg
cgccagctgggcggctggaacaccgacctcggcattccgctggatgccgccgcctacccg
tcgtggcggaacggcgtcaacctgcctgccggccagaagatcgcctacaagtactaccgc
aagaacgccgacggcagcgtcgtctgggaaagcctgaccggcaaccgcagcctgcagacg
ccggccagcggcggcctgaacctgaacgaccaggtcggctggtga

DBGET integrated database retrieval system