KEGG   Chromobacterium sp. ATCC 53434: CXB49_05285Help
Entry
CXB49_05285       CDS       T05234                                 

Gene name
pcaF
Definition
(GenBank) 3-oxoadipyl-CoA thiolase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
chro  Chromobacterium sp. ATCC 53434
Pathway
chro00071  Fatty acid degradation
chro00280  Valine, leucine and isoleucine degradation
chro00281  Geraniol degradation
chro00362  Benzoate degradation
chro00592  alpha-Linolenic acid metabolism
chro01100  Metabolic pathways
chro01110  Biosynthesis of secondary metabolites
chro01120  Microbial metabolism in diverse environments
chro01130  Biosynthesis of antibiotics
chro01212  Fatty acid metabolism
Module
chro_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:chro00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CXB49_05285 (pcaF)
   00592 alpha-Linolenic acid metabolism
    CXB49_05285 (pcaF)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CXB49_05285 (pcaF)
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    CXB49_05285 (pcaF)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CXB49_05285 (pcaF)
   00642 Ethylbenzene degradation
    CXB49_05285 (pcaF)
Enzymes [BR:chro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     CXB49_05285 (pcaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AUH50274
UniProt: A0A2H5DT97
LinkDB All DBs
Position
complement(1118141..1119343)
Genome map
AA seq 400 aa AA seqDB search
MTDAFICDAVRTPIGRFGGSLSGVRADDLAAIPLRALLERNPGLNPEAIDEVILGCANQA
GEDNRNVARMGLLLAGYPVETPGLTVNRLCASGLDAVALAARSIKSGEAELLIAGGVESM
SRAPFVMPKSDKAFGRDLQVHDTTIGWRFVNPAMESQYGVDTMPATAENVAREYGVNRQD
QDAFALRSQQRYFAALETGFFDGEIIPVSIPRRKQDPLIVDRDEHPRQTSPEELAKLKAL
FGPDSSITAGNASGVNDGAAAMIIASAEAAQRHGLRPRARVVASASSGIAPRVMGAGPIE
ASRKALDKAGLSMDDIDVIELNEAFAAQALAVTRALGLPDDCERVNPNGGAIALGHPLGM
SGSRLALTAVAQLQASGKRYALCTMCVGVGQGLALILERV
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgctttcatctgcgacgccgtgcgcacgccgatcggccgcttcggcggctcg
ctgtccggcgtacgcgccgacgatctggcggcgattccgctgcgcgcgctgctggaacgc
aatcccggcctgaacccggaggccatcgacgaggtgatcctgggctgcgccaaccaggcc
ggcgaggacaaccgcaacgtcgcccgcatgggcctgctgctggcgggctacccggtggaa
accccgggcctgacggtgaaccgcctgtgcgcgtccggcctggacgcggtggcgctggcc
gcccgtagcatcaagtccggcgaggccgagctcttgatcgccggcggcgtggagtcgatg
tcgcgcgcgccgttcgtgatgccgaaatcggacaaggccttcggccgcgacctgcaggtc
cacgacaccaccataggctggcgtttcgtcaatccggccatggagagccaatacggcgtg
gacaccatgccggccacggcggaaaacgtggcgcgcgaatacggcgtcaatcgccaggac
caggacgcgttcgcgctgcgcagccagcagcgttatttcgccgcgctggaaaccggcttc
ttcgacggcgagatcattccggtgtcgattccgcgccgcaagcaggatccgttgatcgtc
gaccgcgacgagcacccgcgccagacttcgccggaagagctggccaagctgaaggcgctg
ttcggcccggactccagcatcaccgccggcaacgcctccggcgtcaacgacggcgcggcg
gcgatgatcatcgcctcggccgaggcggcgcaacgccatggcctgcgcccgcgcgcgcgg
gtggtggcgtcggccagctccggcatcgcaccgcgcgtgatgggcgccgggccgatagaa
gccagccgcaaggcgctcgacaaggccggcctgagcatggacgacatcgacgtgatcgag
ttgaacgaggccttcgccgcccaggcgctggcggtcacccgcgcgctgggcctgcccgac
gattgcgaacgggtgaacccgaacggcggcgccatcgcgctgggccacccgctgggcatg
agcggcagccggctggcgctgaccgccgtcgcgcagctgcaggccagcggcaagcgctac
gcgctgtgcacgatgtgcgtcggcgtgggccaaggcctggcgctgattctggaacgcgtc
tga

DBGET integrated database retrieval system