KEGG   Chromobacterium sp. ATCC 53434: CXB49_07765Help
Entry
CXB49_07765       CDS       T05234                                 

Definition
(GenBank) D-alanyl-D-alanine-carboxypeptidase/endopeptidase AmpH
  KO
K18988  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase [EC:3.4.16.4 3.4.21.-]
Organism
chro  Chromobacterium sp. ATCC 53434
Brite
KEGG Orthology (KO) [BR:chro00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:chro01002]
    CXB49_07765
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:chro01011]
    CXB49_07765
Enzymes [BR:chro01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CXB49_07765
   3.4.21  Serine endopeptidases
    3.4.21.-  
     CXB49_07765
Peptidases and inhibitors [BR:chro01002]
 Serine peptidases
  Family S12: D-Ala-D-Ala carboxypeptidase B family
   CXB49_07765
Peptidoglycan biosynthesis and degradation proteins [BR:chro01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   CXB49_07765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase Peptidase_S11
Motif
Other DBs
NCBI-ProteinID: AUH50706
UniProt: A0A2H5DUH4
LinkDB All DBs
Position
complement(1665435..1666718)
Genome map
AA seq 427 aa AA seqDB search
MKKAFLLGLSLVAAPTVSLAAAKAAPAEPQTAEQKIDHYASQIFRNSRAVGMTMVVVNKQ
QALQRFYGQTRPGSRQLPDTDSVLRIASISKTMTGEVLASLAQDKRVKLDDPLQKYAPRG
LALPSTEQPITLLNLASHTSGFPREMPGVKPEDTPVFVWPDQQQRWQWLSASKARFAPGL
RAQYSNLAFDFLADALAAATGRPYAALLREKVTVPLGMRDTTFSPNPGQCARLMEGYGAS
PCVDTSAASGSGGIYSTPRDMQRWLQDLVHPQNEARRQLRDQTFHMYFKRDDLRSLRGMD
VAGKADELGLGWIRMLPTPNSPEIIQKTAGGGGFIGYVAIAPKNDVAVWVGLTRSGGTHY
QNMSDGVNKLVAELSGYHPETRPKPPLHLKPTLARAKPIKAKIRAKAKAKPTAAKAAGKH
TKKRKQT
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaagcgtttttgctggggttgagccttgtcgccgcccctaccgtcagccttgcc
gcggctaaggcggcgccagcggaaccccagaccgcagagcagaaaatcgaccattacgcc
agccagatcttccgcaattcccgagccgtcggcatgacgatggtggtggtgaacaagcaa
caggcgctgcagcgcttctacggccagacccgccccggcagccgccagctgccggacacc
gactccgtgctgcggatcgccagcatcagcaagacgatgaccggcgaagtgctggcatcg
ctggcgcaggacaagcgcgtcaagctggacgatccgctgcagaaatacgcgccgcgcggc
ctggcgctgccgtcgaccgaacagccgatcaccctgctgaatctggccagccacaccagc
ggcttcccgcgtgaaatgcccggcgtcaaacccgaggacacgccggtcttcgtctggccg
gaccagcagcagcgctggcagtggctgtccgccagcaaggcccggttcgcgcccggcctg
cgcgcccagtactccaatctggccttcgacttcctggccgacgcgctggccgccgcgacc
ggccggccgtatgccgccttgctgcgcgagaaggtcaccgtgccgctgggcatgcgggac
accaccttcagtcccaatcccggacaatgcgcgcggctgatggaaggctacggcgccagc
ccctgcgtcgataccagcgccgccagcggcagcggcggcatctactccaccccgcgcgac
atgcagcgctggctgcaggacctggtccatccgcaaaacgaggcccgccgccagctgcgc
gaccagaccttccacatgtatttcaagcgcgacgatctgcgcagcctgcgcggcatggac
gtggccggcaaggccgacgaactgggcctgggctggatacggatgctgccgacgccgaac
tcgccggaaatcatccagaagaccgccggcggcggcggcttcatcggctatgtcgcgatc
gcgccgaagaacgacgtcgcggtctgggtgggcctgacccgcagcggcggcacccactac
cagaacatgagcgacggcgtgaacaagctggtggccgaactgagcggctaccatccggaa
acgcggcccaaaccgccgctgcacctgaaaccgacgctggcgcgcgccaagccgatcaag
gccaagatcagagccaaggcgaaggccaagccgaccgccgccaaggcggccggcaaacac
accaagaagcggaagcagacctag

DBGET integrated database retrieval system