KEGG   Chromobacterium sp. ATCC 53434: CXB49_17730
Entry
CXB49_17730       CDS       T05234                                 

Gene name
icmF
Definition
(GenBank) type VI secretion system membrane subunit TssM
  KO
K11891  type VI secretion system protein ImpL
Organism
chro  Chromobacterium sp. ATCC 53434
Pathway
chro03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:chro00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    CXB49_17730 (icmF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:chro02044]
    CXB49_17730 (icmF)
Secretion system [BR:chro02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   CXB49_17730 (icmF)
SSDB
Motif
Pfam: IcmF-related_N IcmF-related IcmF_C
Other DBs
NCBI-ProteinID: AUH52502
UniProt: A0A2H5DZN0
LinkDB
Position
4016277..4020077
AA seq 1266 aa
MFNKGWLRNAKVASAIGFLILIALIWWLGPWLGLTSAEARLGWIVAVMIVWVLALLIGQA
LARRAGGMLEGMLRRQADDAVINASADKRAEVTLLRQRLLGAIDTLKKSNIGSARGSAAL
YELPWYMIIGHPAAGKSSAILQSGLSFPFSDKSGIQGIGGTRNCDWFFSTEGVLLDTAGR
YATESEDRGEWLAFLKLLKKHRAKAPVNGIMVAISLPELAQHNSEGFVLYARQVRERIHE
VCNTFGLMVPIYLVFTKLDLLGGFAQFFQDAGEEERSRVWGATLSADQGTGFDAGAVVSQ
QFEQLYRGLVQMGEAQLVNAGGNAVKSAHFAFPIEFHGLQEAVVKFVRLLFEEDPYHSRP
LLRGFYFTSALQEGVPRIVTAGRVQGQFDLSSASLDKQQAPASYSYFLRGLFREVLFPDQ
HLIFQQTRPSGSRWRLAGMVAGLVTLAAVAGLWTWSFIGNQQMIAQINVERAQAQKLAAS
GQLYDRLGGLLILQRRLEELQNYRRNGAPWQVGLGLYQGKELERNLRKAYFAGLKDVMLN
PVQRNLETTLAALKPGVAQPVAVTEPAKPPMEAKPAAKPEAKPPAAPAKPHRARPKGHGL
PNINLSALELPQRATTAKLDASAPAADATDKPQQKSPQLDVAYNALKTYLMLHEQKRMEE
AQLADQLPRYWRPWLESQRGEYPVNEVMGQAEKLVAFYVSQIKEADLPLIDNDPKVVADA
RDVLRGSFKRLSAQERVFNEIKARANTRFAPLTVARILDNRDMDIMASSQMVEGAYTREA
WNTYVRGAIDEASRGEIRSDDWVLASSSQDNLGKDGDAEKNRAGLEALYRAQYIAAWHKF
LAGVVVRDIANPAQSASAMARLSDKQNSPIKLILARAAQETAWDNPSELNRSLESAKRSV
LDKTTAFFKSGDAPAEAKGDKQYGTVGMHFAGVAALVKGDNAPINAYLDQLGKLKAKMAT
IATTDQPGPQARAALQATLSGSGSELGDSLSYVDNTLLAGANADTVEMVRPMLVRPLSQS
YSALLGPVAQDINQAWINEVLPQWKQLAGKYPFSDSSNSASVADINRFVKANDGTLDKFV
NKYLSGLVQKKGDELVPRAWGNQGVRFNPEFLVGASRLMALASSQLQDGENSRFELQPLP
TPGLSEIVLSIDGQELRYRNGPQAWQPFNWPGSGGGDGARIQVVNYAGASSVVGNQQGRM
GLMRLLAGAKVNQDGPDGSAQLSWNLPKGSGADGQTVRFNFRMLGGVNPLQLNRLYKLTL
PERVTL
NT seq 3801 nt   +upstreamnt  +downstreamnt
gtgtttaacaaaggttggctacgcaatgccaaggtggcgtccgccatcggattcttgatc
ctgatcgcgctgatctggtggctgggcccatggctcggactgacgtcggcggaggcgagg
ctgggctggatcgtggcggtgatgatcgtatgggtgctggccctgctgatcggccaggcg
ctggcgcgccgcgccggcggcatgctggaggggatgctgcgccgccaggccgacgacgcg
gtgatcaacgccagcgccgacaagcgggcggaagtgacgctgctgcgccagcggctgctg
ggcgcgatcgacacgctgaaaaagtccaatatcggcagcgcccgcggcagcgccgcgctg
tatgagttgccttggtacatgatcatcggacaccccgccgcgggcaagagttccgcgatc
ctgcaatccggcctgtccttcccgttcagcgacaagagcggtatccagggcataggcggc
acccgcaactgcgactggttcttctccaccgagggcgtgttgctggataccgccggccgc
tacgccaccgagagcgaggaccgcggcgagtggctggccttcctgaagctgctgaagaag
caccgcgccaaggcgccggtcaacggcatcatggtggcgatcagcctgccggagctggcc
cagcacaatagcgagggcttcgtgctgtacgcgcgccaggtgcgcgagcgcatccacgag
gtgtgcaataccttcggcctgatggtgccgatctacctggtcttcaccaagctggacctg
ttgggcggcttcgcccagttcttccaggatgccggcgaagaggagcgttcccgggtgtgg
ggcgcgacgctgtcggccgaccagggcaccggtttcgacgccggcgccgtcgtgtcgcag
cagttcgagcagctgtaccgcggtctggtgcagatgggcgaagcgcaattggtgaatgcc
ggcggcaacgccgtcaaatccgcccacttcgccttcccgatcgaattccacggcctgcag
gaagcggtggtcaaattcgtgcggctgctgttcgaggaggatccgtaccactcgcgtccg
ctgctgcgcggcttctacttcaccagcgccctgcaggagggcgtgccgcgcatcgtcacc
gccggccgggtgcagggccagttcgacctgtcctccgccagcctggacaaacagcaggcg
ccggcgtcgtacagctacttcctgcgcggcttgttccgcgaagtgctgttccccgatcag
cacctgatcttccagcagacgcgtcccagcggcagccgctggcgcctggccggcatggtg
gccggcctggtgacgctggcggccgtggccggcttgtggacctggtccttcatcggcaac
cagcagatgatcgcccagatcaacgtcgagcgggcgcaggcgcagaagctggccgcctcg
ggccagctgtacgaccgcctgggcggcctgctgatcctgcagcgcaggctggaggagttg
cagaactaccgccgtaacggcgcgccgtggcaggtgggccttggcctgtaccagggcaag
gagctggagcgcaatctgcgcaaggcctatttcgccggcctgaaggacgtgatgctgaat
ccggtccagcgcaatctggaaaccacgttggcggcgttgaagccgggcgtggcgcagccg
gtggcggtgaccgagccggccaagccgccgatggaggccaagcccgcggctaagccggaa
gccaaaccgccggcggcgccggccaagccgcaccgtgcgcgtccgaagggccacggcctg
cccaatatcaatctgagcgcgctggaattgccgcaacgcgccaccaccgcgaagctggac
gcttcggcgccggctgccgatgcgacggacaagccgcagcagaagtcgccgcagctggac
gtggcctacaacgcgctgaagacctatctgatgctgcatgagcagaagcggatggaggag
gcgcagctggccgaccagctgccgcgctactggcgtccgtggctggaaagccagcgcggc
gaatacccggtcaacgaggtgatgggccaggccgagaagctggtggctttctacgtcagc
cagatcaaggaagccgatctgccgctgatagacaacgatcccaaggtggtggcagacgcc
cgcgacgtgctgcgcggctcgttcaagcggctgtcggcgcaggagcgcgtgttcaacgag
atcaaggcgcgagccaacacgcgtttcgcgccgttgaccgtggcgcgcatcctggacaac
cgcgacatggacatcatggccagcagccagatggtggagggcgcctacacccgcgaggcg
tggaacacctatgtgcgcggcgccatcgacgaggccagccgcggcgaaatccgcagcgat
gactgggtgctggcgtccagcagccaggacaatctcggcaaggacggcgacgcggagaag
aatcgcgccgggctggaggcgctgtatcgcgcccagtacatcgccgcctggcacaagttc
ctggccggcgtggtggtgcgcgacatcgccaacccggcgcagtcggcgtcggcgatggcc
aggctgtcggacaagcagaattcgcctatcaagctgatcctggcgcgcgcggcgcaggaa
accgcctgggacaatccgtccgaattgaaccgttcgctggagagcgccaagcgctcggtg
ctggataagaccaccgccttcttcaagagcggcgacgcgccggccgaggccaagggcgac
aagcagtacggcacggtcggcatgcacttcgccggcgtggccgcgctggtcaagggcgac
aacgcgccgatcaacgcctatctcgaccagctgggcaagctgaaggccaagatggcgacc
atcgccaccaccgaccagccgggtccgcaggcgcgcgccgcgctgcaggcgacgctgagc
ggctccggctccgaattgggcgattccttgtcctatgtcgacaacacgctgctggccggc
gccaacgccgacaccgtggaaatggtgcgtccgatgctggtgcgtccgctgtcgcagtcc
tatagcgcgttgttgggaccggtggcgcaggacatcaaccaggcctggatcaacgaggtg
ctgccgcagtggaagcagctggccggcaagtatccgtttagcgattccagcaacagcgcc
tcggtcgccgacatcaaccgcttcgtcaaggccaacgacggcacgctggacaagttcgtc
aacaaatacctgtccggcctggtgcaaaagaagggcgacgagttggtgccgcgcgcctgg
ggcaaccagggcgtgcgtttcaatccggaattcctcgtcggcgccagccgcctgatggcg
ctggccagcagccagctgcaggacggcgagaacagccgcttcgaactgcagccgctgccg
acgccgggcctgtccgagatcgtgctcagcatagacggccaggaactgcgctaccgcaac
ggcccgcaagcctggcagccgttcaactggccgggcagcggcggcggagacggcgcgcgc
atccaggtggtcaactacgccggcgccagcagcgtggtcggcaaccagcagggccggatg
ggcctgatgcgtctgctggccggggccaaggtcaaccaggacggcccggacggttccgct
cagctgagctggaatctgcccaagggcagcggcgccgacggccagacggtgcgcttcaat
ttccgcatgctgggcggcgtcaacccgctgcagctgaaccgcctctacaaactgacgttg
cctgaacgcgtgacgttgtaa

DBGET integrated database retrieval system