KEGG   Chromobacterium sp. ATCC 53434: CXB49_19655Help
Entry
CXB49_19655       CDS       T05234                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
chro  Chromobacterium sp. ATCC 53434
Pathway
chro00473  D-Alanine metabolism
chro00550  Peptidoglycan biosynthesis
chro01100  Metabolic pathways
chro01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:chro00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CXB49_19655
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CXB49_19655
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CXB49_19655
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:chro01011]
    CXB49_19655
Enzymes [BR:chro01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CXB49_19655
Peptidoglycan biosynthesis and degradation proteins [BR:chro01011]
 Precursor biosynthesis
  Amino acid ligase
   CXB49_19655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATPgrasp_ST ATP-grasp_3 ATP-grasp CPSase_L_D2 RimK ATP-grasp_4 ATPgrasp_YheCD TTL Ub-Mut7C
Motif
Other DBs
NCBI-ProteinID: AUH52845
UniProt: A0A2H5E0L9
LinkDB All DBs
Position
complement(4411521..4412429)
Genome map
AA seq 302 aa AA seqDB search
MKQYGKVAVLMGGSSAEREVSLMSGAGVLAALLAKGVDAHKFDTSEKPLAALKDEGFDSV
FNVLHGPFGEDGTLQGALEALGVPYTGCGVMASAICMDKWRTKLLWKGAGLPIPAFELLS
DDSDFDAIEKALGLPIFVKPSTEGSSIGVTKVKMPGGLKAAYQEASRYDDIVIAEQFIGA
GEYTCAVIGDTAYPTVKIEPATEYYDYDAKYFRDDTVYRCPGLAGDAESRARELCLKAFK
VLGCQGWGRVDFLMDEAGGVYLLEANTNPGMTSHSLVPMAARAEGISYEDLCLKVLDTVH
VG
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagtacggcaaggtggcggtgttgatgggcggaagctcggctgagcgcgaagtg
tcgctgatgagcggcgccggcgtgctggcggcactgctggccaagggagtggacgcccac
aagttcgatacgagcgagaagccgttggctgcgctgaaggacgagggtttcgacagcgtg
ttcaatgtgctgcacggcccgttcggcgaggatggcacgctgcagggcgcgctggaggca
ttgggcgtcccgtataccggttgcggcgtgatggcgtcggcgatctgcatggacaagtgg
cgcaccaagttgttgtggaagggcgcgggcctgccgattccggcgttcgagctgttgagc
gacgacagcgatttcgacgcgatcgagaaggcgctcggcctgcccatcttcgtcaagccg
tcgaccgagggctccagcatcggcgtgaccaaggtcaagatgccgggcggcctgaaggcg
gcgtaccaggaagcgagccgctacgacgacatcgtcatcgccgagcaattcatcggcgcc
ggcgagtacacctgcgcggtgataggcgataccgcctacccgacggtgaagatcgagccg
gcgaccgagtactacgactacgacgccaagtacttccgcgacgataccgtctaccgctgc
cccggcctcgccggcgacgcggaaagccgggcgcgcgaattgtgcctgaaggcgttcaag
gtattgggctgccagggctggggccgggtggatttcctgatggacgaggccggcggcgtg
tatctgctcgaggccaacaccaatccgggcatgaccagccacagcctggtgccgatggcg
gcgcgggcggagggcatcagttacgaagacctgtgtctgaaggtattggatacggtgcat
gtgggataa

DBGET integrated database retrieval system