KEGG   Chromobacterium sp. ATCC 53434: CXB49_19660Help
Entry
CXB49_19660       CDS       T05234                                 

Definition
(GenBank) UDP-N-acetylmuramate--L-alanine ligase
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
chro  Chromobacterium sp. ATCC 53434
Pathway
chro00471  D-Glutamine and D-glutamate metabolism
chro00550  Peptidoglycan biosynthesis
chro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:chro00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    CXB49_19660
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CXB49_19660
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:chro01011]
    CXB49_19660
Enzymes [BR:chro01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     CXB49_19660
Peptidoglycan biosynthesis and degradation proteins [BR:chro01011]
 Precursor biosynthesis
  Amino acid ligase
   CXB49_19660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: AUH52846
UniProt: A0A2H5E0M7
LinkDB All DBs
Position
complement(4412477..4413871)
Genome map
AA seq 464 aa AA seqDB search
MKHRVKHIHFVGVGGVGMCGIAEVLHGLGYTVSGSDMADGATTKRLAAEGVRVFFGHDAT
YIEGADVVVTSTAVKADNPEVLAARDKRIPVIPRAMMLAELMRFKQGIAIAGTHGKTTTT
SLTASVLGAAGLDPTFVIGGKLTAAGTNAKLGLGEFLVAEADESDASFLHLSPVMAVVTN
IDADHMDTYDHSFDKLKQAFVDFLQRMPFYGRAVLCIDDINVREIRERVTKPVTTYGLDE
SADIYAENVRAAAGQMHFDVVVKNGTITRFPLVLNLPGRHNVLNALSAIAIGLECGASIA
AIQKGLSEFAGVGRRFQRYGEVKAKDGGSFTLVDDYGHHPVEMAATLAAVRGAFPGRRLL
LAFQPHRYTRTRDLFEDFVKVLSGVDALLLSEVYAAGEAPIVAADGRALARAVRVGGKVE
PLFVEDIADLPQAIVDAARDGDVVVTMGAGSVGAVPAKVLALAV
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaaacacagggtcaaacacatacatttcgtcggcgtaggcggtgtcggcatgtgcggc
atcgccgaggtgctgcacggcctgggctataccgtgtccggctcggacatggccgacggc
gccaccaccaagcggctggccgccgagggcgtgcgcgtgttcttcggccatgacgccact
tatatcgagggcgccgacgtggtggtcacctcgaccgcggtcaaggccgacaatccggaa
gtgctggcggcgcgcgacaagcgcatcccggtgattccgcgcgcgatgatgctggccgaa
ctgatgcgcttcaagcagggcatcgccatcgccggcacccacggcaagacgacgacgacc
agcctgaccgcgtcggtgctgggcgcggccgggctcgatccgaccttcgtcatcggcggc
aagctgaccgccgccggcaccaacgccaagctgggcctgggcgaattcctggtggccgag
gccgacgagtcggacgcgtccttcctgcatctgagtccggtgatggcggtggtgaccaat
atcgacgccgatcacatggacacctacgaccacagcttcgacaagctgaagcaggccttc
gtcgatttcctgcagcggatgccgttctacggccgcgcggtgctgtgcatagacgacatc
aatgtgcgcgagatccgcgagcgcgtcaccaagccggtgaccacctacggcctcgacgaa
tcggccgacatctacgccgagaacgtgcgcgcggcggccggccagatgcatttcgacgtg
gtggtgaagaacggcaccatcacccgcttcccgctggtgctgaacctgccgggccgccac
aacgtgctgaacgcgctgtcggcgatcgccatcggcctggagtgcggcgccagcatagcg
gcgatccagaagggtctgtccgagttcgccggcgtcggccgccgcttccagcgctacggc
gaggtcaaggcgaaggacggcggcagcttcacgctggtcgacgattacggccaccacccg
gtggaaatggccgcgacgctggccgcggtccgcggcgccttcccgggacgccggctgctg
ctggccttccagccgcaccgctacacccgcacccgcgatctgttcgaggacttcgtcaaa
gtgctgtccggcgtcgacgccttgctgctgtccgaggtgtacgccgccggcgaggcgccg
atcgtcgcggccgacggccgggcgctggcgcgcgcggtgcgcgtcggcggcaaggtggag
ccgctgttcgtcgaggatatcgccgatctgccgcaggccatcgtcgacgcggcgagggac
ggcgacgtggtggtgacgatgggcgccggctcggtcggcgcggtgccggccaaggtgttg
gcgctggctgtttga

DBGET integrated database retrieval system