KEGG   Chromobacterium sp. ATCC 53434: CXB49_19695Help
Entry
CXB49_19695       CDS       T05234                                 

Definition
(GenBank) cell division protein
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
chro  Chromobacterium sp. ATCC 53434
Pathway
chro00550  Peptidoglycan biosynthesis
chro01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:chro00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CXB49_19695
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    CXB49_19695
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:chro01011]
    CXB49_19695
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:chro03036]
    CXB49_19695
Enzymes [BR:chro01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CXB49_19695
Peptidoglycan biosynthesis and degradation proteins [BR:chro01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   CXB49_19695
Chromosome and associated proteins [BR:chro03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    CXB49_19695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer LigD_N
Motif
Other DBs
NCBI-ProteinID: AUH52853
UniProt: A0A2H5E0N4
LinkDB All DBs
Position
complement(4421618..4423369)
Genome map
AA seq 583 aa AA seqDB search
MRAGSSYSVRTRPVPASPALRMTSTRVRCVLLVLALLFLALIGRAVYLQVVQQDFLQNQG
EARFRRTLTLEANRGVITDRNGEPLAISSPVQTIWASPTDMEPVPPAKLRELAGLLDLSP
EELSAKLSDRKKEFVYIKRQISPEQADKVMALGIPGIAKQQEYRRFYPAGEIVSHIIGFT
GVDGKGQEGVELAREKMLAGKDGRRVVLKDRRGHIIEDVAAIEPPRDGQKLALAVDHRIQ
YLAYREIKAAVEANKAKAGSVVVLDAKTGELLALANYPSFNPNNRVGVTPEMMRNRGVID
LFEPGSTMKPLSISLALEHGKANLNTVLDTRTYMIGPATIRDVAPRPSLDILGIIQKSSN
VGTSKLALMNSPEESWKHYDALGFGRAPETGFPGEASGRLRDWHKWRPIEQATMSFGYGL
SVSLIQMARAYTIFANDGVMLPISLYKTSNPMPGKRVLNEKTAHEMRDLLIANSQPGGGA
VGGRIIGYSIGGKSGTARKLEGRSYVANKHRALFMGFAPGHAPRVIVTVMIDEPTAGKYY
GGAVSAPVFSQVAGGALRILNVTPDEPSNNTLLPESTPVPVDF
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccggttccagttacagcgtgcgcacccgcccggtgccggccagcccggcgctg
cggatgaccagcacccgcgtgcgctgcgtgctgctggtgctcgcgctgctgttcctggcg
ctgatcggccgcgcggtctatctgcaggtggtgcagcaggacttcctgcagaaccagggc
gaggcgcgtttccgccgcacgctgacgctggaagccaaccgcggcgtgatcaccgaccgc
aacggcgagccgctggcgatcagctcgccggtgcagaccatctgggccagtccgaccgac
atggagccggtgccgccggccaagctgcgcgagctggccggcctgctggacctgtcgccg
gaggagctgtcggccaagctgtccgaccgcaagaaggaattcgtctacatcaagcgccag
atcagtccggagcaggccgacaaggtgatggcgctgggcatacccggcatcgccaagcag
caggaataccgccgcttctacccggccggcgagatcgtgtcgcacatcatcggcttcacc
ggcgtggacggcaagggccaggaaggcgtcgagctggcccgcgagaagatgctggcgggc
aaggacggccgccgggtggtgctgaaggacagacgcggccacatcatcgaggacgtcgcc
gccatcgagccgccgcgcgacggccagaagctggcgctggcggtggaccaccgcatccag
tacctggcctaccgcgagatcaaggccgcggtggaggccaacaaggccaaggccggcagc
gtggtggtgctggacgccaagaccggcgaattgctggcgctggccaattatccgtcgttc
aacccgaacaaccgcgtcggcgtgacgccggagatgatgcgcaaccgcggcgtgatcgac
ttgttcgagcccggttcgacgatgaagccgctgtcgatctcgctggcgctggagcacggc
aaggccaatctgaacaccgtgctggatacccgcacttacatgatagggccggcgacgata
cgcgacgtggcgccgcgtcccagcctggacattctcggcatcatccagaagtcgtccaac
gtcggcaccagcaagctggcgctgatgaacagcccggaagagtcctggaagcattacgac
gcgctgggcttcggccgcgcgccggaaaccggcttccccggcgaggccagcggccggctg
cgcgactggcacaagtggcgcccgatcgagcaggcgacgatgtccttcggctacggcctg
tcggtcagcctgatccagatggcgcgcgcctacaccattttcgccaacgacggcgtgatg
ctgccgatctcgctgtacaagacgtcgaatccgatgccgggcaagcgggtgctcaacgag
aagaccgcgcacgagatgcgcgacctgctgatcgccaacagccagccgggcggcggcgcc
gtcggcggccgcatcatcggctacagcataggcggcaagagcggcaccgcgcgcaagctg
gagggccgcagctatgtggccaacaagcaccgcgcgctgttcatgggcttcgcgccgggc
cacgcgcccagggtgatcgtgacggtgatgatagacgaacccacggcgggcaagtattac
ggcggcgccgtgtcggccccggtgttctcgcaggtggcgggcggcgcgctgcgcatattg
aacgtcacgccggacgagccatccaacaacactttattgccggaatcgaccccggttccg
gtggatttctaa

DBGET integrated database retrieval system