KEGG   Chryseobacterium sp. 3008163: EAG08_02450Help
Entry
EAG08_02450       CDS       T05679                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
chrs  Chryseobacterium sp. 3008163
Pathway
chrs00620  Pyruvate metabolism
chrs00680  Methane metabolism
chrs01100  Metabolic pathways
chrs01120  Microbial metabolism in diverse environments
chrs01200  Carbon metabolism
Module
chrs_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:chrs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EAG08_02450
  09102 Energy metabolism
   00680 Methane metabolism
    EAG08_02450
Enzymes [BR:chrs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     EAG08_02450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AYM99344
LinkDB All DBs
Position
complement(562167..564701)
Genome map
AA seq 844 aa AA seqDB search
MRHDQRAEKFRQIVENKFQIYNSLFMSLPYDKMTNIGMLLPFLYEESKEGYHAGKTPEQI
VEEFFANHTDLHTEEQKLELLFKIIQYIERQVVLFDSIEDAAFPNLHSESDSGTVTNLFE
RSLQDHKLEKVREKLRDFTVKVVFTAHPTQFYPSSVQRILHDLRKSITDDSITNIDMLLQ
QLGKTPFVNKEKPTPIDEALSIIHYLRYVYYDTIGELFTKIKTTFGNGHFHLHEDLIQLG
FWPGGDRDGNPFVTADVTKRVSEELRSAILKSYYGNLKDVRRRLSFRGVSEVLGQLSAEL
YTAIFRNERITAEDILKRLNEAEKILVEQHNSLFIDQLENFKDRVKIFGTHFATLDIRQD
SRIHQQVIDDVYKAKFGESEVSNDEKFNQLIQVSEKIDADGFEDIIKDTLINVAQVKDIQ
FANGNRGMNRYIISNSDAVKDVMNVYAFFKITGYKDEEINMDIVPLFETMEGLDNAESVM
TELYKNPIYQKHLERRGNQQTIMLGFSDGTKDGGYLKANWEIYKAKEVLTKLSEENGIKV
VFFDGRGGPPARGGGKTHDFYASQGKTIANNKIELTIQGQTITSIFGNKEQAKYNFEQLL
TAGVENDVFKNSKKDLTEKERALILELANISYKKYSDLKAHPMFVPYLQEMSTLEYYGKT
NIGSRPSKRGGGNELKFEDLRAIPFVGSWSQLKQNVPGFFGFGFAMQQLKEEGRFDEVRE
LYKGSDFFKTLVLNSMMSMNKSYFPLTYYIKDNPKFGEFWNVLFSEYNLSKDIMLELTGF
KMLQEEDPLSRKSVKIREKIVLPLLSIQQYALMKIQKGEGNKEAYEKLVTRSLFGNINAS
RNSA
NT seq 2535 nt NT seq  +upstreamnt  +downstreamnt
atgagacacgaccagcgcgcagaaaaattcaggcagattgtagaaaataaatttcaaatt
tacaattcattatttatgagcctgccttatgataaaatgaccaacatcgggatgctactc
ccgtttttatatgaagaaagcaaagagggttaccatgccggaaaaactcctgaacaaatc
gtagaagaattctttgctaatcataccgatttacatacagaggaacaaaaactcgaattg
ttgtttaaaatcattcagtatattgagagacaagttgttttgtttgatagtattgaagat
gcagcgttcccaaatttacattctgaaagtgacagcggaacggtaaccaatctttttgag
cgctcattgcaagatcataaactggagaaagtgcgtgaaaagttgcgagattttacggtg
aaagtagtttttaccgctcaccccactcagttttatccgagttcggtacagagaattctg
catgatttaagaaaatcaatcactgacgattcgattaccaatattgacatgcttttgcag
caattagggaaaactccattcgtgaataaagaaaagccaactccgattgatgaggctttg
agcatcattcattatctgaggtatgtttattacgatacgattggcgaattatttaccaaa
atcaaaacgacttttggcaatgggcattttcatttgcatgaagatctcattcagcttggt
ttctggccgggtggtgacagagacggaaatccttttgtgacagcagatgttacgaaaaga
gtttctgaagaactgcgttcagccattttaaaatcatattatggaaatttaaaagatgta
agaagaagattaagtttcagaggagtttcggaagttctgggacaactgagtgctgagctt
tatactgcgatttttagaaatgaaagaatcaccgcagaagatattcttaaaagattaaat
gaagccgagaaaatattggtagaacaacataattctcttttcatcgatcagcttgaaaat
ttcaaagaccgtgtgaagatcttcggaactcactttgcaactttggatatcagacaagac
agcagaatccaccaacaggtgattgatgatgtttataaagctaaatttggtgaatctgag
gttagcaacgatgagaaatttaatcagttaattcaggtttcagagaaaatagatgctgat
ggttttgaggatattataaaagatactttaatcaacgtcgctcaggtaaaagatattcag
tttgccaacggaaaccgagggatgaatcgatacatcatctccaattctgatgcggtgaaa
gatgtgatgaatgtgtatgcattcttcaaaattacaggctacaaggacgaagaaatcaat
atggatattgttccgctttttgaaacgatggaaggtctagataatgccgaaagtgtaatg
accgaattgtataaaaatccgatttatcagaaacatcttgagagaagagggaatcagcag
acgattatgcttgggttctcagacggaactaaagacggaggttatttgaaagccaattgg
gaaatttataaagcgaaagaagttttgactaaactgtcagaagagaatggtattaaagta
gtcttcttcgacggtagaggcggtccaccggcaagaggtggtggaaaaacacacgatttc
tacgcttctcaaggaaaaactattgccaataataaaattgaattaaccatccaggggcaa
accattacaagtattttcggaaataaagagcaggcaaagtataattttgaacagctgttg
actgccggagtagaaaatgatgtgtttaaaaactctaaaaaggatttaactgaaaaagaa
agagcgctaattcttgagctggccaatatcagttataaaaaatattcagatttaaaggcg
catccgatgtttgtcccttatcttcaggagatgagtacactcgaatattacggaaaaacc
aatatcggaagtcgtccgtcaaaacgtggtggtggaaacgagttgaaatttgaagattta
agagccattccttttgtaggatcctggtcgcagttgaaacagaatgttcccggtttcttc
ggttttggttttgcaatgcagcagttgaaagaagagggaagattcgacgaagtgagagaa
ttgtataaaggttctgacttctttaaaactttagttttaaactcaatgatgagtatgaac
aaatcctatttcccattgacttactatattaaagataatcctaaattcggtgaattctgg
aatgtccttttcagtgaatataatctttcaaaagatattatgctggaattgactgggttt
aaaatgcttcaggaagaagatccattgtcaagaaagtcggtgaaaattcgtgagaaaatt
gtgcttccgttgttgagcattcaacaatacgctttaatgaaaattcagaaaggtgaagga
aataaagaagcatatgaaaaattggtaacgagatcgttgttcggtaatattaatgcgagt
aggaattcagcttaa

DBGET integrated database retrieval system